KEGG   Helicobacter pylori ELS37: HPELS_01115Help
Entry
HPELS_01115       CDS       T01798                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00010  Glycolysis / Gluconeogenesis
hpe00020  Citrate cycle (TCA cycle)
hpe00620  Pyruvate metabolism
hpe00640  Propanoate metabolism
hpe00650  Butanoate metabolism
hpe00680  Methane metabolism
hpe01100  Metabolic pathways
hpe01120  Microbial metabolism in diverse environments
hpe01130  Biosynthesis of antibiotics
hpe01200  Carbon metabolism
Module
hpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPELS_01115
   00020 Citrate cycle (TCA cycle)
    HPELS_01115
   00620 Pyruvate metabolism
    HPELS_01115
   00640 Propanoate metabolism
    HPELS_01115
   00650 Butanoate metabolism
    HPELS_01115
  Energy metabolism
   00680 Methane metabolism
    HPELS_01115
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPELS_01115
Enzymes [BR:hpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPELS_01115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: AFF19800
UniProt: H8H7K6
Position
complement(221451..222395)
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFDSNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgaaaaatttcaaggc
tcgcacttgctttgcccaggttgtgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggctgtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctaca
gcgatttcaggggtggaggcgatgtataaagcgctagtgaataagggccgctatcaaggt
caaaagccaaaatttgtggcgtttgggggcgatggggccagttatgatattggtcttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcttggataatgaa
aactacgccaataccggcggtcaaagaagcggatctacgccattaggggctagcacttct
accacgccagcgggatcggtgagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggggtcccttatgtggcgcaactctcgcctaacaaatggaaagac
atgaataaaaagattaaaaccgcactagacactgaagggccttgctttatcaacgctctt
agcccatgcacgactgaatggaaatttgattccaataagaccattgaattagcggatatg
gctgtggatagcttgatgttccccttgtttgaaatctttaatggtagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaggaaaacgaacacattattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system