KEGG   Helicobacter pylori ELS37: HPELS_01500Help
Entry
HPELS_01500       CDS       T01798                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00450  Selenocompound metabolism
hpe00970  Aminoacyl-tRNA biosynthesis
hpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HPELS_01500
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPELS_01500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpe01007]
    HPELS_01500
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hpe03016]
    HPELS_01500
Enzymes [BR:hpe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HPELS_01500
Amino acid related enzymes [BR:hpe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HPELS_01500
Transfer RNA biogenesis [BR:hpe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HPELS_01500
 Prokaryotic type
   Other AARSs
    HPELS_01500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AFF19869
UniProt: H8H804
Position
299805..301742
Genome map
AA seq 645 aa AA seqDB search
MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAR
LRNQSPKAYADSISAIFKDQWDFFNLDYDSFIRTTDSEHQKCVQNAFEIMFEKGDIYKGA
YSGYYCVSCESYCAASKADNTNDKVLCPDCLRETTLLEEESYFFKLSAYEKPLLEFYAKN
PEAILPIYRKNEVTSFIEQGLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNGLDNKMAHFERARHIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGV
KMSKSLGNVLDAQKLAMEYGIEELRYFLLREVPFGQDGDFSKKALIERINANLNNDLGNL
LNRLLGMAKKYFNYSLKSAKITAYYSKELEKVHQILDNANSFVPKMQLHKALEELFNVYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANVLLQSSFLLYAFMPKSAMKLASAFCVEI
TPNNYERFFKAKKLQDMILQDTEPLFCKMEKVEKAPLKENQEKEKKAEKEKAPPTQENYI
SIEDFKKVEIKVGLIKEAQRIEKSNKLLRLKVDLGENRLRQIISGIALDYEPESLVGQMV
CVVANLKPAKLMGEMSEGMILAVRDSDNLALISPTREKIAGSLIS
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaacccccatttattatgtgaatgacatccctcatattggc
catgcttatacgactttgattgcggacactttaaagaagtattacacgcttcaaggcgaa
gaagtcttttttttaaccggcaccgatgagcatgggcaaaagatcgaacaaagcgcgaga
ttgagaaatcaaagccctaaagcttacgccgatagcattagcgcgatttttaaagaccaa
tgggattttttcaatttagattatgatagttttatccgcaccacagacagcgagcatcaa
aaatgcgtgcaaaacgcctttgaaatcatgtttgaaaagggggatatttataaaggcgct
tatagtgggtattattgcgtgagctgtgagagttattgcgcggcttctaaagcggacaac
acgaacgataaagtcttatgccctgattgcttgagggagaccacgcttttagaagaagag
agttatttttttaaattgagcgcatatgagaagcctttattggagttttacgccaaaaac
cctgaagcgattttgcctatttatcgtaaaaatgaggtaacttcttttattgagcagggt
ttattggatctgtctatcacgcgcacgagttttgaatggggcattcctttgcctaaaaaa
atgaacgatcctaaacatgtggtgtatgtttggctggacgctttattgaattatgcgagc
gcgttagggtatttgaacggtttagacaataaaatggcgcattttgaacgcgctaggcat
attgtgggtaaggatattttacgcttccatgctatttattggccagcctttttgatgagt
ttgaatttgcccctattcaaacagctttgcgtgcatgggtggtggacgatagagggcgtg
aaaatgagtaagagcttgggtaatgttttagacgctcaaaagctcgctatggagtatggg
attgaagaattacgttattttttattgcgtgaagtgccttttggacaagatggggatttt
tctaaaaaagcgttaatagaaaggatcaatgcgaatttgaataacgatttggggaatttg
ttgaatcgcttgctaggcatggctaaaaaatatttcaattattctctaaaaagcgccaaa
atcaccgcttattattctaaagagctagaaaaagtgcatcaaattttagataacgctaat
tcttttgtgcctaaaatgcaattgcataaagctttagaggaattgtttaacgtttatgat
tttttaaacaaactcatcgctaaagaagagccatgggttttgcacaaaaacaacgaatca
gaaaaactagaagccttattgagcttgatcgcaaacgtgctgttgcaatcaagctttttg
ctctatgcgttcatgccaaagagcgctatgaaattagcgagcgctttttgtgtagaaatc
acgcccaataattacgaacgcttttttaaagctaaaaaattacaagacatgattttacaa
gacaccgagcctttattttgtaaaatggaaaaagtggaaaaagccccactaaaagaaaat
caagaaaaagaaaaaaaagcagaaaaagaaaaagccccaccaacacaagaaaactatatc
agcattgaagattttaagaaagtagaaattaaagtggggcttattaaagaagctcaaagg
attgaaaaatccaataaattactgcgcttaaaagtggatttaggcgaaaatcgtttgagg
cagattatctcagggatcgctttggattatgagcctgaaagtttggtggggcaaatggtg
tgcgtggtggctaatttaaaacccgccaagctcatgggcgaaatgagtgagggcatgatt
ttagcggtgcgagatagcgataatttggctttaatcagccctactagagaaaaaatcgca
ggaagtttgatcagttaa

DBGET integrated database retrieval system