KEGG   Helicobacter pylori ELS37: HPELS_03040Help
Entry
HPELS_03040       CDS       T01798                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00071  Fatty acid degradation
hpe00072  Synthesis and degradation of ketone bodies
hpe00280  Valine, leucine and isoleucine degradation
hpe00310  Lysine degradation
hpe00362  Benzoate degradation
hpe00380  Tryptophan metabolism
hpe00620  Pyruvate metabolism
hpe00630  Glyoxylate and dicarboxylate metabolism
hpe00640  Propanoate metabolism
hpe00650  Butanoate metabolism
hpe00900  Terpenoid backbone biosynthesis
hpe01100  Metabolic pathways
hpe01110  Biosynthesis of secondary metabolites
hpe01120  Microbial metabolism in diverse environments
hpe01130  Biosynthesis of antibiotics
hpe01200  Carbon metabolism
hpe01212  Fatty acid metabolism
hpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPELS_03040
   00630 Glyoxylate and dicarboxylate metabolism
    HPELS_03040
   00640 Propanoate metabolism
    HPELS_03040
   00650 Butanoate metabolism
    HPELS_03040
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPELS_03040
   00072 Synthesis and degradation of ketone bodies
    HPELS_03040
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPELS_03040
   00310 Lysine degradation
    HPELS_03040
   00380 Tryptophan metabolism
    HPELS_03040
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPELS_03040
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPELS_03040
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPELS_03040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpe04147]
    HPELS_03040
Enzymes [BR:hpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPELS_03040
Exosome [BR:hpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPELS_03040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFF20160
UniProt: H8H4J3
Position
611337..612512
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVGAREMGVSVLKDALNASSLKPSDVDSVILGNVLGAG
LGQNIARQIQLDSGIPNDRNAFSVNMVCGSSMKAIQLAHDSIVLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQTLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDIHLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKKSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaagcgtagtgctgtagggagttttttaggctct
ctaaagaatgtgggcgctagagaaatgggcgttagcgtgcttaaagacgctttgaatgcg
agctctcttaagcctagcgatgtggattctgtcattttaggcaatgtcttaggtgctggt
ttgggtcaaaatatcgctagacagatccaattggattctggtatccctaatgacagaaac
gcttttagcgtcaatatggtttgcggatcgtctatgaaagctatccaattagcgcatgat
agcattgtgcttgggcgcgatgaagtggtggtgtgcggtggcgtggagaatatgagcgca
gcgccttatctgtcgtttgatatgcgagacgggaaaagaatggggaatgcgaacatgata
gattccatgatacatgacggattatgggatgcgttcaatgattatcacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagagcaagataatttcgcgctc
caatcgcaactcaaagcgagagccgccattaatgcagggaagttccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgcttttaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
aaaaaagcgcaaacattggggttaaaaaccatggcaactatcaaggggtttggtttgggt
ggttgcagtccagatataatgggtatatgccccagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatccatctttttgaactcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggtgcgagcggtgctaggatcttagtaacttta
ttgcatgaaatgaagaaaagcggtcatggcgtgggttgcgcgtcattgtgtgtgggcggt
gggcaaggtctatcagtggtagttgaacaaaaataa

DBGET integrated database retrieval system