KEGG   Helicobacter pylori ELS37: HPELS_04590Help
Entry
HPELS_04590       CDS       T01798                                 

Definition
(GenBank) phosphatidylglycerophosphate synthase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00564  Glycerophospholipid metabolism
hpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPELS_04590
Enzymes [BR:hpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     HPELS_04590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: AFF20454
UniProt: H8H5D7
Position
943348..943887
Genome map
AA seq 179 aa AA seqDB search
MKVLKLLPNFLTILRIVLSLFLLFLLLNTRTYFSFLTPFHINMISSLVFLFAALTDLLDG
YIARNYKAKSRFGEIFDPLADKILILSAFLGLVYLDRVNAWIPFVILGREFFISGLRVLA
ANEKKDIPVNALGKYKTVSQVVAIGALLANLTYSYVLVAIAVFLTLYSGIDYTIKYYKS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttaaaactcctgcctaattttttaacgattttacgcattgtcttatcctta
tttttattgtttttattgttaaacacgcgcacttattttagttttttaaccccctttcac
atcaacatgatttcttcattggtttttttatttgccgcgctcacggatttattggacggc
tacatcgctagaaactataaagccaaatcgcgctttggggaaatctttgatcctttagcg
gataaaatccttattttgagcgcgtttttagggctagtttatttggatcgtgtgaatgcg
tggatcccgtttgtgattttagggcgcgaattttttatttcagggcttagggttttagcc
gctaatgaaaaaaaggatattcctgtcaatgcgttaggcaagtataaaaccgtttctcaa
gtcgtggcgattggcgctttattagccaatttaacttactcctatgtgcttgtggccata
gcggtttttttaaccctttattcggggatagattacacgattaaatattataaatcttaa

DBGET integrated database retrieval system