KEGG   Helicobacter pylori ELS37: HPELS_07685Help
Entry
HPELS_07685       CDS       T01798                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hpe  Helicobacter pylori ELS37
Brite
KEGG Orthology (KO) [BR:hpe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HPELS_07685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RnlB_antitoxin DUF1240 NnrS
Motif
Other DBs
NCBI-ProteinID: AFF21048
UniProt: H8H7T0
Position
complement(1538778..1540379)
Genome map
AA seq 533 aa AA seqDB search
MEIRNIKEFEKASKKLQKDTLKIALALLFLIGAALLALIFGQANSKGLLLIFAAVIGGYM
AMNIGANDVSNNVGPAVGSKAISMGGAILIAAICEMLGAIIAGGEVVSTIKGRIVSPEFI
NDAHVFINVMLASLLSGALWLHVATLIGAPVSTSHSVVGGIMGAGMAAAGMAAVNWHFLS
GIVASWVVSPLMGALIAMFFLMLIKKTIAYKEDKKSAALKVVPYLVALMSLAFSWYLMVK
VLKRLYAVGFEIQLACGCILALLIFILFKRFVLKKAPQLENSHESVNELFNVPLIFAAAL
LSFAHGANDVANAIGPLAAISQTLEDASSPMGSTLSSVPLWIMVVGAAGIALGLSLYGPK
LIKTVGSEITELDKMQAFCIALSAVITVLLASQLGLPVSSTHIVVGAVFGVGFLRERLRE
QSRRRFARIRDNIVAAHFGEDLEEIEGFLERFDKANLKEKSLMLESLKKSKNTAIALELK
KKEKKSLKKVYKEEVIKRSILKKIVTAWLVTVPVSVLLGALLFVALGFIEKYF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaattagaaacatcaaagagtttgaaaaagcttccaaaaaactccaaaaagacact
ttaaagatcgctctcgctcttttgtttctcatcggtgctgctttgctcgctctcattttt
gggcaggctaattctaagggattgttgcttatttttgcggctgtgattggggggtatatg
gcgatgaatattggcgcgaacgatgtgtctaataatgtcggccctgccgtaggctctaaa
gccattagcatgggcggggcgattttgatcgctgcgatttgtgaaatgcttggagcgatc
attgctgggggggaagtggtttctacgattaagggccgtatcgtttcgcctgaatttatt
aacgatgcgcatgttttcattaatgtcatgttggctagcttgctcagtggggcgttgtgg
ttgcatgtggcgactttaataggcgctcccgtttccacttcacactctgtagtggggggg
attatgggggctggaatggcagcagctggaatggcagcggtcaattggcattttttatcc
ggcattgtggctagttgggtagtctcgcctttaatgggggctttgatagccatgttcttt
ttaatgctcattaaaaagactatcgcttataaagaagataaaaagagcgcggctttaaag
gtcgtgccttatttggtagcgttgatgagcttagcctttagctggtatttgatggttaag
gttttaaaacgcctctatgcggtgggttttgaaatccaactggcttgcggctgcatcctt
gcgcttttaatctttatcctttttaaaagatttgtgttaaagaaagccccgcaattagaa
aatagccatgaaagcgttaatgagcttttcaatgtccctttgatttttgccgccgcgctt
ttaagcttcgcccatggggctaatgatgtggctaacgctattggccccttagccgcaatc
agtcaaactttagaagatgcgagcagccctatggggagtactttaagctctgtgccgttg
tggattatggtagtgggggcagctgggatcgctttaggcttgagtttgtatgggccaaaa
ctcattaaaacggtggggtctgaaatcacagaattagacaaaatgcaagccttttgcatt
gcgctttctgcagtcatcaccgtgcttttagcctctcaattaggcttgccggtaagctct
acgcatattgtggtgggcgcggtgtttggggtgggctttttaagggagcgtttaagagag
caatccagaaggcgttttgctagaatcagagacaacattgtagcagcgcactttggggaa
gatttagaagaaattgaaggctttttagagcgctttgataaagccaatttgaaagaaaaa
tcgctcatgctagagagcttgaaaaaaagcaaaaacaccgccatcgctttggaattgaaa
aagaaagaaaaaaagtcgcttaaaaaagtgtataaagaagaagtgatcaaacgctccatt
ttaaaaaagattgttaccgcttggttggtaaccgtgccggtttctgtgcttttaggcgcg
cttctttttgtggctcttggttttatagaaaagtatttctag

DBGET integrated database retrieval system