KEGG   Helicobacter pylori ELS37: HPELS_07920Help
Entry
HPELS_07920       CDS       T01798                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpe  Helicobacter pylori ELS37
Pathway
hpe00220  Arginine biosynthesis
hpe00330  Arginine and proline metabolism
hpe01100  Metabolic pathways
hpe01110  Biosynthesis of secondary metabolites
hpe01130  Biosynthesis of antibiotics
hpe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPELS_07920
   00330 Arginine and proline metabolism
    HPELS_07920
Enzymes [BR:hpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPELS_07920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFF21091
UniProt: H8H7X3
Structure
PDB: 

Position
complement(1593616..1594584)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYFFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDTKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVGAIRENMHEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLGAVEVTEYNPTVNAKHNNEEEEQVLE
ILDLIIKRCKIKDKERSFARSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcggaattaggggcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaggctttgagcgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaggagtttagatacgctaagaattttgaa
gattactactttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgagaaa
aaagaatttcctttaattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaagacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgatacaaagcacattcacggcatgcccttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtgggcgcgataagagaaaacatgcatgaagtggttcaaaaaaccaaa
gaattgttaaaagcggtggatattatttaccttagcttggatttagacattatggatggc
aagcttttcacctctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaaag
caattactgggtttgcttttagaaagttttaaagaccgattaggggcggttgaggtaacc
gaatacaaccccacggtgaacgccaaacacaataacgaagaagaagagcaggttttagaa
atcttggatctcatcattaagcgctgtaaaattaaagacaaggagcgatcttttgcaagg
agttactga

DBGET integrated database retrieval system