KEGG   Helicobacter pylori F30: HPF30_0120Help
Entry
HPF30_0120        CDS       T01895                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpf  Helicobacter pylori F30
Pathway
hpf00260  Glycine, serine and threonine metabolism
hpf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpf01100  Metabolic pathways
hpf01110  Biosynthesis of secondary metabolites
hpf01130  Biosynthesis of antibiotics
hpf01230  Biosynthesis of amino acids
Module
hpf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF30_0120 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF30_0120 (trpA)
Enzymes [BR:hpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPF30_0120 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: BAJ56217
UniProt: E6NHG4
Position
108741..109529
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQEKMAFIPFVTLGDPNYALSFEIIKTLITSGVSALELGFAFSDPVADG
VTIQASHLRALKHATMGKNFQLLKEIRSYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASDKDLEQAAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKTFSPTPALLGFGISKKEHIKNAKNMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFIGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgcattgagttttgaaatcattaaaaccttaatc
actagtggggtgagcgctttagaattggggtttgctttttcagatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaagcatgctactatgggaaaaaatttc
cagcttttaaaagagattagaagttacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgccagtcccaatgcgagtgataaagat
ttagaacaagccgctatgcattcgcaaggctatatctacactctggctaggagtggggtt
acaggggcgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaact
tttagccccacaccggccttattaggctttggcatttctaaaaaagaacacataaaaaac
gctaaaaacatgggtgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctggaaaaaattaaagggtttataggagaaatg
attttttaa

DBGET integrated database retrieval system