KEGG   Helicobacter pylori F30: HPF30_0642Help
Entry
HPF30_0642        CDS       T01895                                 

Gene name
thl
Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpf  Helicobacter pylori F30
Pathway
hpf00071  Fatty acid degradation
hpf00072  Synthesis and degradation of ketone bodies
hpf00280  Valine, leucine and isoleucine degradation
hpf00310  Lysine degradation
hpf00362  Benzoate degradation
hpf00380  Tryptophan metabolism
hpf00620  Pyruvate metabolism
hpf00630  Glyoxylate and dicarboxylate metabolism
hpf00640  Propanoate metabolism
hpf00650  Butanoate metabolism
hpf00900  Terpenoid backbone biosynthesis
hpf01100  Metabolic pathways
hpf01110  Biosynthesis of secondary metabolites
hpf01120  Microbial metabolism in diverse environments
hpf01130  Biosynthesis of antibiotics
hpf01200  Carbon metabolism
hpf01212  Fatty acid metabolism
hpf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPF30_0642 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    HPF30_0642 (thl)
   00640 Propanoate metabolism
    HPF30_0642 (thl)
   00650 Butanoate metabolism
    HPF30_0642 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPF30_0642 (thl)
   00072 Synthesis and degradation of ketone bodies
    HPF30_0642 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPF30_0642 (thl)
   00310 Lysine degradation
    HPF30_0642 (thl)
   00380 Tryptophan metabolism
    HPF30_0642 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPF30_0642 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPF30_0642 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPF30_0642 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpf04147]
    HPF30_0642 (thl)
Enzymes [BR:hpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPF30_0642 (thl)
Exosome [BR:hpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPF30_0642 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAJ56739
UniProt: E6NIY6
Position
complement(677428..678603)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALNASTLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGVSIIILCSAQKAQKLGLKAMAAIKGFGLGGCSPDIMGICPSIAIRNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagtgctgtggggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgctgtcgtgcttaaagacgctttgaatgcg
agcactcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgctggt
ttgggtcaaaatatcgccagacagatccaactggacgcaggcataccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggagaatatgagtgca
gcgccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcaaacatgata
gactccatgatccatgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccatatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacctgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgtaagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaagcaatggcggctatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattagaaacaatcttaaa
aatgtcaaaatgaatctcaacgacattaatctttttgaactcaatgaagctttcgccgca
caaagcatagccgtattaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcaagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggctgtgcgtcattgtgtgtgggtggc
ggacaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system