KEGG   Helicobacter pylori G27: HPG27_1052Help
Entry
HPG27_1052        CDS       T00777                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00010  Glycolysis / Gluconeogenesis
hpg00020  Citrate cycle (TCA cycle)
hpg00620  Pyruvate metabolism
hpg00640  Propanoate metabolism
hpg00650  Butanoate metabolism
hpg00680  Methane metabolism
hpg01100  Metabolic pathways
hpg01120  Microbial metabolism in diverse environments
hpg01130  Biosynthesis of antibiotics
hpg01200  Carbon metabolism
Module
hpg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPG27_1052
   00020 Citrate cycle (TCA cycle)
    HPG27_1052
   00620 Pyruvate metabolism
    HPG27_1052
   00640 Propanoate metabolism
    HPG27_1052
   00650 Butanoate metabolism
    HPG27_1052
  Energy metabolism
   00680 Methane metabolism
    HPG27_1052
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPG27_1052
Enzymes [BR:hpg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPG27_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ACI27805
UniProt: B5Z8A6
Position
1156007..1157230
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQSYGSFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFKIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIVHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaattgcaagagatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cctattgtgcagagttatggctcgtttaaggataatggctatgttgatggcgaattcgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagctgcagctgccggtggt
agagtcagcactgcgaccagctctcaaggtttggcgttaatggtagaggttttataccaa
gcttctggcatgcgtttgcctattgttttgaatttagtcaatcgcgctctagcagcccct
ttaaatattcatggcgatcattctgatatgtatttaagcagggattcaggctggatcagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttaaaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttatcaattcgtgggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggtgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgccatcatgagtgcgtcttct
gtgattgaagaagtgttcaatgattttgctaaactcacaggcaggcaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaggccggcgtggccact
atccattccttacgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gctttagcgattttagacaagagctctccagcgggcgctatgggggcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacgatcgtgcatttatgcgagatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggtttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system