KEGG   Helicobacter pylori G27: HPG27_1263Help
Entry
HPG27_1263        CDS       T00777                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hpg  Helicobacter pylori G27
Pathway
hpg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HPG27_1263 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hpg03011]
    HPG27_1263 (rplV)
Ribosome [BR:hpg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HPG27_1263 (rplV)
  Bacteria
    HPG27_1263 (rplV)
  Archaea
    HPG27_1263 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 ptaRNA1_toxin
Motif
Other DBs
NCBI-ProteinID: ACI28011
UniProt: B5Z8W2
Position
complement(1369902..1370270)
Genome map
AA seq 122 aa AA seqDB search
MSKALLRFVRLSPTKARLIARQIQGMNAELAIASLEFTPNKAARVLSKVVASAVANGSLD
AKSTLIVSCRVDAGPVLRRSIPRAKGRATAIRKPTSHVFVEVAEGKEMKSSKSHKKNQAE
GK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcgttattaagatttgtgcggttatctcctactaaagccagattgattgca
agacagattcaaggcatgaacgctgaattagcgatcgctagtttggaatttacgcccaat
aaagcggccagagtgctttcaaaagtggtggcttctgcggtcgctaacggctctttagac
gccaagagcactctgattgtttcttgcagagtggatgctggccctgtgcttaggcgctcc
attccaagggctaaaggcagagccacagccattagaaagccaacatctcatgtattcgta
gaagtagcagaagggaaagaaatgaaatcttctaaaagccataaaaaaaatcaagcagaa
ggtaagtag

DBGET integrated database retrieval system