KEGG   Helicobacter pylori G27: HPG27_1414Help
Entry
HPG27_1414        CDS       T00777                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hpg  Helicobacter pylori G27
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HPG27_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RnlB_antitoxin DUF1240 NnrS
Motif
Other DBs
NCBI-ProteinID: ACI28159
UniProt: B5Z9B0
Position
complement(1528099..1529700)
Genome map
AA seq 533 aa AA seqDB search
MEIKNIKEFEKASKKLQKDTLKIALALLFLIGAALLALIFGQANSKGLLLIFAAVIGGYM
AMNIGANDVSNNVGPAVGSKAISMGGAILIAAICEMLGAIIAGGEVVSTIKGRIVSPEFI
NDAHVFINVMLASLLSGALWLHVATLIGAPVSTSHSVVGGIMGAGMAAAGMSAINWHFLL
GIVASWVISPLMGALIAMFFLMLIKKTIAYKEDKKSAALKVVPYLVALMSLTFSWYLMVK
VLKRLYAVGFEIQLACGCILALLIFILFKRFVLKKAPQLENSHESINELFNVPLIFAAAL
LSFAHGANDVANAIGPLAAISQTLEDANSPMGNTLSSVPLWIMVVGAAGIALGLSLYGPK
LIKTVGSEITELDKMQAFCIALSAVITVLLASQLGLPVSSTHIVVGAVFGVGFLRERLRE
QSRRRFARIRDNIVAAHFGEDLEEIEGFLERFDKANLKEKSLMLESLKKSKNTAIALELK
KKEKKSLKKVYKEEVIKRSILKKIVTAWLVTVPVSALLGALLFVALGFIEKYF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaacatcaaagagtttgaaaaagcttccaaaaaactccaaaaagacact
ttaaagatcgctctcgctcttttgttcctcatcggtgccgctttgctcgctctcattttt
gggcaggctaattctaagggattgttgcttatttttgcggccgtgattgggggctatatg
gcgatgaatattggcgctaatgacgtgtctaacaatgtcggccctgccgtaggctctaaa
gccattagcatgggcggggcgattttgatcgctgcgatttgtgaaatgcttggagcgatc
attgccgggggggaagtggtttctacgattaagggccgtatcgtttcgcctgaatttatt
aatgatgcgcatgttttcattaatgtcatgttggctagcttactcagtggggcgttgtgg
ttgcatgtggcgactttaataggcgctcccgtttccacttcacactctgtggtggggggg
attatgggggctggaatggcagcagctggaatgtctgctattaattggcatttcttatta
ggcattgtggcgagttgggtaatctcgcctttaatgggggctttgatagccatgtttttt
ttaatgctcattaaaaagactatcgcttataaagaagataaaaagagcgcggctttaaag
gtcgtgccttatttggtagcgttgatgagcttaacatttagctggtatttgatggttaag
gttttaaaacgcctttatgcggtgggttttgaaatccaactggcttgtggctgtatcctt
gcgcttttaatttttattctttttaaaagatttgtgttaaaaaaagccccgcaattagaa
aatagccatgaaagcattaatgagcttttcaatgtccctttgatttttgccgccgcactt
ttaagctttgcgcatggggctaatgatgtggctaacgctataggccctttagcagctatc
agtcaaactttagaagatgcaaatagccctatggggaatactttaagctctgtgccgttg
tggattatggtagtaggggcagctgggatcgctttaggcttgagcttgtatgggccaaag
ctcattaaaacggtggggtctgaaatcacagaattagacaaaatgcaagctttttgcatc
gcgctttcagcagtcattaccgtgcttttagcctctcaattaggcttgccggtaagctct
acgcatattgtggtgggtgcggtgtttggggtgggctttttaagggagcgcttaagggag
caatcaagaaggcgttttgccagaatcagagacaatattgtagcggcgcactttggggaa
gatttagaagaaattgaaggttttttagagcgctttgataaagccaatttgaaagaaaaa
tcgctcatgctagagagcttgaaaaaaagcaagaacaccgccatcgctttggaattgaaa
aagaaagaaaaaaagtcgcttaaaaaagtgtataaagaagaagtgatcaaacgctccatt
ttaaaaaagattgttaccgcttggttggtaaccgtgccggtttctgcgcttttaggtgcg
cttctttttgtggctcttggttttatagaaaagtatttctag

DBGET integrated database retrieval system