KEGG   Helicobacter pylori G27: HPG27_481
Entry
HPG27_481         CDS       T00777                                 

Gene name
cag3
Definition
(GenBank) cag pathogenicity island protein 3
  KO
K12088  cag pathogenicity island protein 3
Organism
hpg  Helicobacter pylori G27
Pathway
hpg05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpg_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPG27_481 (cag3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpg02044]
    HPG27_481 (cag3)
Secretion system [BR:hpg02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPG27_481 (cag3)
SSDB
Motif
Pfam: Cytadhesin_P30
Other DBs
NCBI-ProteinID: ACI27244
UniProt: B5Z6P5
Position
514715..516160
AA seq 481 aa
MFRKLATAVSLIGLLTSNTLYAKEISEADKVIKATKETKETKKEVKRLKKEAKQRQQIPD
HKKPQYASVDDTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSI
ENPIIKTRAMGTYADLIIITGSLEQVNGYYNILKALNKRNAKFVLKINENMPYAQATFLR
VPKRSDPNAHTLDKGASIDENKLFEQQKRAYFNYANDVICRPNDEVCSPLRDEMVAMPTS
DSTTQKPNIIAPYSLYRLKEKNNANEAQPSPYATQTAPENSKEKLIEELIANSQLIANEE
EREKKLLAEKEKQEAELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVEVPISPKTSNS
DETMRVVKEKENYNGLLVDKETTIKRSYEGTLISENSYSKKSPINPNDLRSLEEEIKSYY
IKSNGLCYANGISLYAKIKNDPYKEGMLCGYESVQNLLSPLKDKLKYDKQKLQKALLKDS
K
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtttagaaaactagcaaccgctgtatcgctcataggcttactaacctctaacactctt
tatgctaaagaaataagtgaagccgataaggtcattaaggccactaaagaaactaaagag
accaagaaagaagttaaacgactcaaaaaagaagctaaacagcgccaacagatccctgat
cataagaaacctcaatatgcctctgttgatgacacaaaaactcaagcgctgtttgatata
tacgacaccttgaatgtgaatgacaaaagctttggggattggtttggtaatagcgctttg
aaagacaaaacctatctctacgctatggatctattggattacaacaactatttatccata
gaaaaccccattatcaaaacaagagcgatggggacttatgcggatctcatcatcatcaca
ggttcgttagaacaagtcaatgggtattacaacattctaaaagcgctcaacaaacgaaac
gctaagtttgtgttaaaaatcaatgagaacatgccttatgcccaagcgacttttttaaga
gtgccaaaaagaagcgatcccaatgcccacacgcttgataagggagcgtcaattgatgag
aacaagctttttgaacaacaaaaacgcgcgtatttcaactacgccaacgatgtgatctgc
agacccaatgatgaagtgtgttcgcccctaagagatgagatggtcgctatgcccactagc
gatagcactactcaaaaacccaatatcattgctccttatagcttgtatagactaaaagag
aaaaataacgccaatgaggcccaaccatcaccttatgccactcaaaccgctcctgaaaac
agcaaagagaagctcatagaagagctaatcgctaactcccaactcatagccaatgaagaa
gagagggaaaagaaactcttagcagaaaaagaaaaacaagaggctgaattggctaaatac
aagctcaaagacttagaaaatcaaaagaaactaaaagctttagaagcagagttgaaaaag
aaaaatgctaagaaacctagagtagtggaagtgcctatttcccctaaaacaagtaattct
gatgaaacaatgagggttgttaaagaaaaagaaaactataatgggttattagtggataaa
gagaccacgatcaaaagaagctatgaggggactttgatcagtgaaaattcttacagcaaa
aaatctcctatcaaccctaatgacttgaggagcttagaagaagaaatcaaaagctactat
atcaagtctaacggcttgtgttacgctaatggtatcagcctctatgcaaaaatcaaaaac
gacccctataaggagggaatgctgtgtggttatgagagcgttcaaaatctgctctcacct
ctaaaggacaagctcaaatacgacaagcaaaagttacaaaaagcgttactgaaagattca
aagtaa

DBGET integrated database retrieval system