KEGG   Helicobacter pylori G27: HPG27_484
Entry
HPG27_484         CDS       T00777                                 

Definition
(GenBank) virB11-like cag pathogenicity islandencoded protein / ATPase protein
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg03070  Bacterial secretion system
hpg05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpg_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPG27_484
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPG27_484
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpg02044]
    HPG27_484
Enzymes [BR:hpg01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     HPG27_484
Secretion system [BR:hpg02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HPG27_484
SSDB
Motif
Pfam: T2SSE ABC_tran DEAD AAA_7 FtsK_SpoIIIE ATP_bind_1 AAA_19 ResIII Mg_chelatase Pox_A32 AAA_22 AAA_32 IPPT TrwB_AAD_bind AAA_16 Septin DUF87 GARS_A AAA_30 Zeta_toxin HATPase_c_2 AAA_33
Other DBs
NCBI-ProteinID: ACI27247
UniProt: B5Z6P8
Structure
PDB: 

Position
complement(519048..520040)
AA seq 330 aa
MTEDRLSAEDKKFLEVERALKEAALNPLRHATEELFGDFLKMENITEICYNGNKVVWVLK
NNGEWQPFDVRDRKAFSLSRLMHFARCCASFKKKTIDNYENPILSSNLANGERVQIVLSP
VTVNDETISISIRIPSKTTYPHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGT
GSGKTTYIKSIMEFIPKEERIISIEDTEEIVFKHHKNYTQLFFGGNITSADCLKSCLRMR
PDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLANMSSSNSAARNIKFE
SLIEGFKDLIDMIVHINHHKQCDEFYIKHR
NT seq 993 nt   +upstreamnt  +downstreamnt
atgactgaagacagattgagtgcagaagataaaaaatttctagaagtagaaagagcttta
aaagaagcggcattaaatcctttaaggcatgctactgaagaactttttggtgatttttta
aaaatggaaaatatcactgagatttgttacaatgggaacaaggttgtatgggttttaaaa
aataatggcgaatggcaaccatttgatgtgagagacaggaaagcctttagtttgtctcgt
ttaatgcattttgctcggtgctgtgcaagttttaagaaaaaaacaatagacaactatgaa
aatcctattttgagcagcaatttagcgaatggtgaaagggtgcagattgtcctttcccct
gttacagttaatgatgaaaccatttccatatccataaggatacctagcaaaacaacctat
cctcatagcttctttgaagagcagggtttttataatctactagataacaaagaacaagcg
atcagtgcgattaaagatggtattgctattggtaaaaatgtgattgtttgtggtggcaca
ggaagcggtaaaacgacttatatcaaaagcatcatggagtttatccccaaagaagaaagg
atcatatccattgaagacaccgaagagattgtattcaaacaccacaagaactacacgcag
cttttttttggtgggaatatcacctctgctgattgcttaaagtcatgtttgagaatgcga
cctgatagaatcattttaggagaactcagaagcagtgaggcatacgatttttataatgtg
ctttgtagcggtcataaaggtacactaaccactctgcatgcagggagcagtgaagaagcg
tttatccgtttagccaacatgagttcatctaatagtgcagcaaggaatatcaagtttgaa
agtctcattgagggctttaaagatttgattgatatgattgttcatatcaaccaccacaaa
cagtgtgatgaattttatatcaaacataggtag

DBGET integrated database retrieval system