KEGG   Helicobacter pylori G27: HPG27_488
Entry
HPG27_488         CDS       T00777                                 

Gene name
cagW
Definition
(GenBank) cag pathogenicity island protein W
  KO
K12094  cag pathogenicity island protein 9
Organism
hpg  Helicobacter pylori G27
Pathway
hpg05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpg_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPG27_488 (cagW)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpg02044]
    HPG27_488 (cagW)
Secretion system [BR:hpg02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPG27_488 (cagW)
SSDB
Other DBs
NCBI-ProteinID: ACI27250
UniProt: B5Z6Q1
Position
complement(528123..529730)
AA seq 535 aa
MFNIKRTFLVTIISFFLIIPNWLKAIDLPIVSNLKIYQTVYCMLIPSYVLTNKSFADILT
GYTSIGASGSGKSSGQGVIEALSTPLATSLAASNLVKYLNTLGPLWGSAWASVATAIQGF
ALTPSSGCNFGWNALINKNIDVSMDSVLDNLSNKIQNFTKGGVEDNVKGNILLQIIGSIT
AQASTNITADGLIWLIGKEFTANKLQNNTTAMLAFAALESVVKGADAAVLPAYGVVNLPD
IIIGQGSYLDFVSYLIYIVFGIFVFISFMKLRDISNGIQLNIGFEYMRFVGGTLFKMAMV
SFIAYAGFGYLYKISYSIYFGLAGAFGLNQVLFWALDLVLNYTVNSILPAVRAVFSNVGN
NAPSLLQGLQVAGISLFAIFMQVTIIMRISTVVVKPLIAGAFSGIVFPIAVCLIVLDWFK
DSMKNILIWFINNLFILVLAIPILLFGVLALLAFNLTITPSVAIQNINQGGLGIDSTIAS
LITLFILKGFIETIIESVNAIVNTIFSSVSMDGSRMDRERDALMVGRVGGSMFKG
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgtttaatattaaaaggacttttttagtaacgatcataagtttttttctcattattcct
aattggttgaaagctattgatttgcccattgtttcaaatctcaaaatttaccaaacagtt
tattgcatgctgataccaagttatgttttaaccaacaaaagttttgcagatattttgaca
ggctatacatctattggtgcatcagggagtggaaagagttcagggcagggtgtgatcgaa
gcgcttagcacaccattggccacaagtttagccgctagcaatttggtgaaatatttgaat
actttaggtcctttatggggatcggcgtgggcaagtgttgctacagctatacaaggtttt
gctctaacgccatcaagtggctgtaattttggttggaacgcattgataaataaaaacata
gatgtatccatggatagcgtgctagacaatttgagcaacaagattcagaattttaccaaa
ggcggtgttgaggacaatgtgaaaggcaatattcttttacaaataattggctcaataacc
gctcaagcttctacgaatattacagctgatggtttaatttggctgattggtaaagaattc
actgcaaataaactgcaaaacaacactacagccatgcttgcttttgccgcattagaatct
gttgtcaaaggagcggacgctgctgttcttcctgcatatggtgtagtcaatctgcctgat
attatcatagggcaagggtcatatcttgattttgtttcttacctaatttatattgttttt
gggatttttgtttttatttcttttatgaaattgagggatatttcaaatggcattcagctt
aacataggttttgaatacatgcgatttgttggggggacattattcaaaatggcgatggtc
tcttttatcgcctatgcaggttttggttatctttataaaatctcttattctatttatttt
ggtttagcaggtgcttttgggctgaatcaagttcttttttgggctttagatttagtgctg
aattacactgttaattcaattttacctgcggtaagagctgttttttctaatgttggcaac
aacgctcctagtttgttacaaggtttgcaagtggcaggtatttctttatttgctattttt
atgcaagtaactatcattatgagaataagcactgttgttgtgaaacctttgatagcgggg
gcttttagcggtattgtgttccctattgcggtatgtttgatcgtgctagattggttcaaa
gattctatgaaaaacatactgatatggtttattaataatttgtttatcctagttctagct
attcctattttgctctttggtgttttggcattattggctttcaatttgaccataacgccc
tctgttgctatacagaacatcaatcaagggggactaggtatcgattcaactattgcgagt
ttgatcaccctatttattttaaaaggtttcatagagacgattattgagagtgtcaatgcg
atcgttaataccattttcagctctgtttctatggatggtagcagaatggatagagaaaga
gatgccttaatggtaggaagagttggtggatctatgtttaaaggctag

DBGET integrated database retrieval system