KEGG   Helicobacter pylori G27: HPG27_491
Entry
HPG27_491         CDS       T00777                                 

Gene name
cagT
Definition
(GenBank) cag pathogenicity island protein T
  KO
K12097  cag pathogenicity island protein 12
Organism
hpg  Helicobacter pylori G27
Pathway
hpg05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpg_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPG27_491 (cagT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpg02044]
    HPG27_491 (cagT)
Secretion system [BR:hpg02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPG27_491 (cagT)
SSDB
Motif
Pfam: Cag12
Other DBs
NCBI-ProteinID: ACI27253
UniProt: B5Z6Q4
Structure
PDB: 
6OEE

Position
531553..532395
AA seq 280 aa
MKVRASVLTGATILCLILSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTP
FMVQVKLPNYKDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDF
YLQPTLNQKGVVMIASNYNDNPNSKEKPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQ
VINEVAREKAQLEKINQYYKTLLQDKEQEYTTRKNNQREILETLSNRAGYQMRQNVISSE
IFKNGNLNMQAKEEEVREKLQEERENEYLRNQIRSLLSGK
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaaagtgagagcaagtgttttaactggtgcgacaattctgtgcttaattttaagtgca
tgcagtaattatgcgaaaaaagtggtgaaacaaaagaaccatgtttatacgcctgtgtat
aatgaactgatagagaagtatagtgagatacccttaaatgacaaactcaaagacacacca
ttcatggtgcaagtgaagttgccaaattacaaggattatttgttggataataaacaagtt
gtactaactttcaaacttgttcatcattctaaaaagattacgctcataggcgatgccaat
aagatcctccaatacaagaattacttccaagctaacggggcaagatccgacattgatttt
tacttgcaacccactttgaatcaaaagggtgtggtgatgatagcgagtaactacaatgat
aatcctaacagcaaagaaaaaccacagacctttgatgtgttgcaaggaagtcagccaatg
ctaggagctaacacaaaaaacttgcatggctatgatgtgagtggagcaaacaacaagcaa
gtgatcaatgaagtggcaagagaaaaagctcagctagaaaaaatcaatcagtattacaag
actctcttacaagacaaggaacaagaatataccactaggaaaaataaccaacgagaaatt
ttagaaacattgagtaatcgtgcaggttatcaaatgaggcagaatgtgattagttctgag
atttttaagaatggcaacttgaacatgcaagccaaagaggaagaagttagggagaagcta
caagaagaaagagagaatgaatacttgcgcaatcaaatcagaagtttgctcagtggtaag
tga

DBGET integrated database retrieval system