KEGG   Helicobacter pylori G27: HPG27_496
Entry
HPG27_496         CDS       T00777                                 

Gene name
cagN
Definition
(GenBank) cag pathogenicity island protein N
  KO
K12102  cag pathogenicity island protein 17
Organism
hpg  Helicobacter pylori G27
Pathway
hpg05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpg_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPG27_496 (cagN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpg02044]
    HPG27_496 (cagN)
Secretion system [BR:hpg02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPG27_496 (cagN)
SSDB
Motif
Pfam: UPF0231 PEHE
Other DBs
NCBI-ProteinID: ACI27258
UniProt: B5Z6Q9
Position
538245..539165
AA seq 306 aa
MKSIFKKLGSVALYSLVVYGGLNAINTALLPSEYKELVALGFKKIKTLHQRHDDEEVTEE
EKEFATNALREKLRNDRARAEQIQKNIEAFEKKNNSSIQKKAAKHKGLQELNEINANPLN
GNPNSNSSTETKSNKDDNFDEMINKVNEAFVKPAAPLVPDEWRTPEIEIIINECIISSND
YDGLRKCLIKDIKDQKILAPLLEKIQEIETENNKFSRQHLSGLRLVLNNSNNRTFLIASC
AICEKRKKEMEQENNYQDTTNASEFGATDTKENEAKDATFSNNRSKSELPNSVINQIEQS
IAHGKK
NT seq 921 nt   +upstreamnt  +downstreamnt
ttgaaaagcatcttcaaaaaattaggctctgtcgctctttattctttagttgtttatggg
ggcttaaacgctatcaatacagcattattgccgagtgaatacaaagaattagtggctttg
ggctttaaaaaaatcaaaacactccatcaaagacatgacgacgaagaagttacagaagag
gaaaaagaattcgccactaacgctttgagagaaaaattacgaaatgatagggcgagagca
gagcaaattcaaaagaatattgaagcgtttgaaaaaaagaacaactcttctattcaaaaa
aaagcggctaagcacaaaggattacaagaattaaacgaaattaacgctaaccctttgaat
ggcaatcctaatagcaattcttccactgaaaccaaatctaataaagatgataactttgat
gagatgatcaataaggtgaatgaagcttttgtaaaacctgctgctccgcttgtgcctgat
gagtggagaacgcctgaaattgaaatcattatcaatgagtgtattatttcaagcaacgat
tacgatgggttaagaaagtgtttgatcaaagacatcaaggatcaaaaaattcttgccccc
ttattagaaaaaatccaagaaatagagacagaaaataacaagttttctagacaacacttg
agtggtttaagactcgttcttaataacagcaacaatagaacctttcttatagcttcgtgt
gctatttgtgagaagagaaaaaaagaaatggagcaagaaaataactaccaagatactaca
aatgcaagtgagtttggagctactgatacaaaagaaaatgaagcaaaagatgcaacattc
tcaaacaatcgctctaaatctgaactgcccaatagcgtcattaatcaaatagaacaaagc
atcgctcatggaaaaaaatag

DBGET integrated database retrieval system