KEGG   Helicobacter pylori G27: HPG27_504
Entry
HPG27_504         CDS       T00777                                 

Gene name
cagD
Definition
(GenBank) cag pathogenicity island protein D
  KO
K12109  cag pathogenicity island protein 24
Organism
hpg  Helicobacter pylori G27
Pathway
hpg05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpg_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPG27_504 (cagD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpg02044]
    HPG27_504 (cagD)
Secretion system [BR:hpg02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPG27_504 (cagD)
SSDB
Motif
Pfam: CagD
Other DBs
NCBI-ProteinID: ACI27266
UniProt: B5Z6R7
Structure
PDB: 
3CWX 3CWY

Position
complement(546492..547115)
AA seq 207 aa
MINNNSNKKLGGFFLKVLLSLVVFSSYGSANDDNQAKKEAQEKEKNTPNGLVYTNLDFDS
FKATIKNLKDKKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPIIEKIFDEKGKE
MGLNVELQINPEVKDFFTFKSISTTNKQRCFLSLRGETREILCDDKLYNVLLAVFNSYDP
NDLLKHISTVESLKKIFYTITCEAVYL
NT seq 624 nt   +upstreamnt  +downstreamnt
ttgatcaacaataatagtaataaaaaactaggaggcttttttttgaaagttctcttaagt
ctcgttgttttcagttcgtatgggtcagcaaatgacgataatcaagccaaaaaagaagca
caagaaaaagaaaaaaacactcccaatgggcttgtttatacgaatttagattttgatagt
tttaaagcgactatcaaaaatttgaaagacaagaaagtaactttcaaagaagtcaatccc
gatattatcaaagatgaagtttttgacttcgtgattgtcaatagagtccttaaaaaaata
aaggatttgaagcattacgatccaatcattgaaaaaatctttgatgaaaagggtaaagaa
atgggattgaatgtagaattgcagatcaatcctgaagtgaaagacttttttactttcaaa
agcatcagtacgaccaataaacaacgctgctttctgtcattgcgcggagaaacaagagaa
attttatgcgatgataagctatacaatgttttattggccgtattcaattcttatgatcct
aatgatcttttgaaacatattagcaccgtagagtctctcaaaaaaatcttttatacgatt
acatgtgaagcggtatatctataa

DBGET integrated database retrieval system