KEGG   Helicobacter pylori G27: HPG27_507
Entry
HPG27_507         CDS       T00777                                 

Gene name
cagA
Definition
(GenBank) cytotoxin-associated protein A
  KO
K15842  cytotoxicity-associated immunodominant antigen
Organism
hpg  Helicobacter pylori G27
Pathway
hpg05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpg_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPG27_507 (cagA)
SSDB
Motif
Pfam: CagA_N CagA DUF5659
Other DBs
NCBI-ProteinID: ACI27269
UniProt: B5Z6S0
Structure
PDB: 
4IRV

Position
548263..551955
AA seq 1230 aa
MTNETINQQPQTEAAFNPQQFINNLQVAFLKVDNAVASYDPDQKPIVDKNDRDNRQAFNG
ISQLREEYSNKAIKNPAKKNQYFSDFIDKSNNLINKDALIDVESSTKSFQKFGDQRYQIF
TSWVSHQNDPSKINTRSIRNFMENIIQPPIPDDKEKAEFLKSAKQSFAGIIIGNQIRTDQ
KFMGVFDESLKERQEAEKNGGPTGGDWLDIFLSFIFDKKQSSDVKEAINQEPVPHVQPDI
ATTTTDIQGLPPEARDLLDERGNFSKFTLGDMEMLDVEGVADIDPNYKFNQLLIHNNALS
SVLMGSHNGIEPEKVSLLYGGNGGPKAKHDWNATVGYKDQQGNNVATIINVHMKNGSGLV
IAGGEKGINNPSFYLYKEDQLTGSQRALSQEEIRNKVDFMEFLAQNNAKLDNLSEKEEEK
FRNEIKDFQKDSKAYLDALGNDRIAFVSKKDTKHSALITEFGNGDLSYTLKDYGKKADKA
LDREKNVTLQGNLKHDGVMFVDYSNFKYTNASKNPNKGVGVTNGVSHLEAGFSKVAVFNL
PDLNNLAITSLVRRDLEDKLIAKGLSPQETNKLVKDFLSSNKELVGKALNFNKAVAEAKN
TGNYDEVKQAQKDLEKSLKKRERLEKEVAKKLESKSGNKNKMEAKSQANSQKDEIFALIN
KEANREARAITYAQNLKGIKRELSDKLENVNKNLKDFSKSFDEFKNGKNKDFSKSEETLK
ALKGSVKDLGINPEWISKVENLNAALNEFKNGKNKDFSKVTQAKSDLENSVKDVIINQKV
TDKVDNLNQAVSVAKATGDFSRVEQALADLKNFSKEQLAQQAQKNEDFNTGKNSALYQSV
KNGVNGTLVGNGLSKAEATTLSKNFSDIKKELNAKLGNFNNNNNNGLKNSTEPIYAKVNK
KKAGQAASPEEPIYAQVAKKVNAKIDRLNQIASGLGVVGQAVGFPLKRHDKVGDLSKVGQ
SVSPEPIYATIDDLGGPFPLKRHDKVGDLSKVGLSVSPEPIYATIDDLGGPFPLKRHDKV
GDLSKVGLSREQQLKQKIDNLSQAVSEAKAGFFGNLEQTIDNLKDSAKNNPVSLWAEGAK
KVPASLSAKLDNYATNSHTRINSNIQSGAINEKATGMLTQKNPEWLKLVNDKIVAHNVGS
VPLLEYDKIGFNQKSMKDYSDSFKFSTELNNAVKDVKSGFTQFLANAFSTGYYRLAGENA
EHGIKNVNTKGGSKNLKGLRNTKNAKTTPC
NT seq 3693 nt   +upstreamnt  +downstreamnt
atgactaacgaaaccattaaccaacaaccacaaactgaagcggcttttaacccgcagcaa
tttatcaataatcttcaagtggcttttcttaaagttgataacgctgtcgcttcatacgat
cctgatcaaaaaccaatcgttgataagaacgatagggataacaggcaagcttttaatgga
atctcgcaattaagggaagaatactccaataaagcgatcaaaaatcctgccaaaaagaat
cagtatttttcagactttatcgataagagcaataatttaatcaacaaagacgctctcatt
gatgtagaatcttccacaaagagctttcagaaatttggggatcagcgttaccaaattttc
acaagttgggtgtcccatcaaaacgatccgtctaaaatcaacacccgatcgatccgaaat
tttatggaaaatatcatacaaccccctatccctgatgataaagaaaaagcagagtttttg
aaatctgccaaacaatcttttgcaggaattatcatagggaatcaaatccgaacggatcaa
aagttcatgggcgtgtttgatgaatccttgaaagaaaggcaagaagcagaaaaaaatgga
gggcctactggtggggattggttggatatttttctctcatttatatttgacaaaaaacaa
tcttctgatgtcaaagaagcaatcaatcaagaaccagttccccatgtccaaccagatata
gccactaccaccaccgacatacaaggcttaccgcctgaagctagagatttacttgatgaa
aggggtaatttttctaaattcactcttggcgatatggaaatgttagatgttgagggagtc
gctgacattgatcctaattacaagttcaaccaattattgattcacaataacgctctgtct
tctgtgttaatggggagtcataatggcatagaacctgaaaaagtttcattgttgtatggg
ggcaatggtggtcctaaagctaagcatgattggaacgccaccgttggttataaagaccaa
caaggtaacaatgtggctacaataattaatgtgcatatgaaaaacggcagtggcttagtc
atagcaggtggtgagaaagggattaataatcctagtttttatctctacaaagaagaccaa
ctcacaggctcacaacgagcattgagtcaagaagagatccgaaacaaagtagatttcatg
gaatttcttgcacaaaataatgctaaattagacaacttgagcgagaaagaggaagaaaaa
ttccgaaatgagattaaggatttccaaaaagactctaaggcttatttagacgccctaggg
aatgatcgtattgcttttgtttctaaaaaagacacaaaacattcagctttaattactgag
tttggtaatggggatttgagctacactctcaaagattatgggaaaaaagcagataaagct
ttagatagggagaaaaatgtcactcttcaaggtaacctaaaacatgatggcgtgatgttt
gttgattattctaatttcaaatacaccaacgcctccaagaatcccaataagggtgtaggc
gttacgaatggcgtttcccatttagaagcaggctttagcaaggtagctgtctttaatttg
cctgatttaaataatctcgctatcactagtttagtaaggcgggatttagaggataaacta
atcgctaaaggattgtccccacaagaaactaataagcttgtcaaagattttttgagcagc
aacaaagaattggttggaaaagctttaaacttcaataaagctgtagctgaagctaaaaac
acaggcaactatgatgaagtgaaacaagctcagaaagatcttgaaaaatctctaaagaaa
cgagagcgtttggagaaagaagtagcgaaaaaattggagagcaaaagcggcaacaaaaac
aaaatggaagcaaaatctcaagctaacagccaaaaagatgagatttttgcgttgatcaat
aaagaggctaatagggaggcaagagcaatcacttacgctcaaaatcttaaaggcatcaaa
agggaattgtctgataaacttgagaatgtcaacaaaaatttgaaagactttagtaaatct
tttgatgaattcaaaaatggcaaaaataaggatttcagcaagtcagaagaaacactaaaa
gcccttaaaggctcggtgaaagatttaggtatcaatccagaatggatttcaaaagttgaa
aaccttaatgcagctttgaatgaattcaaaaatggcaaaaataaggatttcagcaaggta
acgcaagcaaaaagcgaccttgaaaattccgttaaagatgtgatcatcaatcaaaaggta
acggataaagttgacaatctcaatcaagcggtatcagtggctaaagcaacgggtgatttc
agtagggtagagcaagcgttagccgatctcaaaaacttctcaaaggagcaattggctcaa
caagctcaaaaaaatgaagatttcaatactggaaaaaattctgcactataccaatccgtt
aagaatggtgtgaatggaaccctagtcggtaatgggttatctaaagcagaagccacaact
ctttctaaaaacttttcggacatcaagaaagagttgaatgcaaaacttggaaatttcaat
aacaataacaataatggactcaaaaacagcacagaacccatttatgctaaagttaataaa
aagaaagcagggcaagcagctagccctgaagaacccatttacgctcaagttgctaaaaag
gtaaatgcaaaaattgaccgactcaatcaaatagcaagtggtttgggtgttgtagggcaa
gcagtgggcttccctttgaaaaggcatgataaagttggtgatctcagtaaggtagggcaa
tcagttagccctgaacccatttatgctacgattgatgatctcggcggacctttccctttg
aaaaggcatgataaagttggtgatctcagtaaggtagggctttcagttagccctgaaccc
atttatgctacgattgatgatctcggcggacctttccctttgaaaaggcatgataaagtt
ggtgatctcagtaaggtagggctttcaagggagcaacaattgaaacagaagattgacaat
ctcagtcaagcggtatcagaagctaaagcaggtttttttggcaatctagaacaaacgata
gacaatctcaaagattctgcaaaaaacaatcctgtgagtctatgggctgaaggtgcaaaa
aaagtgcctgctagtttgtcagcgaaactagacaattacgctactaacagccacacacgc
attaatagcaatatccaaagtggagcaatcaatgaaaaagcgaccggtatgctaacgcaa
aaaaaccctgagtggctcaagctcgtgaatgataagatcgttgcgcataatgtaggaagc
gttcctttgttagagtatgataaaattggcttcaaccagaagagtatgaaagattattct
gattcgttcaagttttccaccgagttgaacaatgctgtaaaagatgttaagtctggcttt
acgcaatttttagccaatgcattttctacaggatattaccgcttggcgggagaaaatgca
gagcatggaatcaaaaatgttaatacaaaaggtggttccaaaaatcttaaaggattaagg
aataccaaaaacgcaaaaaccaccccttgctaa

DBGET integrated database retrieval system