KEGG   Helicobacter pylori G27: HPG27_646Help
Entry
HPG27_646         CDS       T00777                                 

Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00071  Fatty acid degradation
hpg00072  Synthesis and degradation of ketone bodies
hpg00280  Valine, leucine and isoleucine degradation
hpg00310  Lysine degradation
hpg00362  Benzoate degradation
hpg00380  Tryptophan metabolism
hpg00620  Pyruvate metabolism
hpg00630  Glyoxylate and dicarboxylate metabolism
hpg00640  Propanoate metabolism
hpg00650  Butanoate metabolism
hpg00900  Terpenoid backbone biosynthesis
hpg01100  Metabolic pathways
hpg01110  Biosynthesis of secondary metabolites
hpg01120  Microbial metabolism in diverse environments
hpg01130  Biosynthesis of antibiotics
hpg01200  Carbon metabolism
hpg01212  Fatty acid metabolism
hpg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPG27_646
   00630 Glyoxylate and dicarboxylate metabolism
    HPG27_646
   00640 Propanoate metabolism
    HPG27_646
   00650 Butanoate metabolism
    HPG27_646
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPG27_646
   00072 Synthesis and degradation of ketone bodies
    HPG27_646
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPG27_646
   00310 Lysine degradation
    HPG27_646
   00380 Tryptophan metabolism
    HPG27_646
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPG27_646
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPG27_646
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPG27_646
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpg04147]
    HPG27_646
Enzymes [BR:hpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPG27_646
Exosome [BR:hpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPG27_646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACI27405
UniProt: B5Z756
Position
707044..708219
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVCVLKDALNASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDADIPNDRNAFSVNMVCGSSMKAIQLAHDAIMLGCDEVVVCGGVENMSK
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNNYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NIKMNLNDIHLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaagcggagtgctgtagggagttttttaggctct
ctaaagagcgtgggtgctagagaaatgggtgtttgcgtgcttaaagacgctttgaatgcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggcgctggt
ttgggtcaaaatatcgccagacagatccaactggacgctgacatccctaatgacagaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgat
gccatcatgcttgggtgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcaaa
gcaccctatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatacatgatgggttgtgggatgcgttcaataattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagagcaagataatttcgcactc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggtgcgagcattatcattttatgcagcgct
aaaaaagcacaaaaattggggttaaaaaccatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagcatcgctattaaaaacaaccttaaa
aatatcaaaatgaatctcaatgacatccatctttttgaactcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggatattagtgacttta
ttgcatgaaatgaaaaggagcgggcatggcgtgggttgcgcgtcattgtgcgtgggcggc
ggtcaagggctatcagtggtagttgaacaaaaataa

DBGET integrated database retrieval system