KEGG   Helicobacter pylori G27: HPG27_79Help
Entry
HPG27_79          CDS       T00777                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00020  Citrate cycle (TCA cycle)
hpg00620  Pyruvate metabolism
hpg01100  Metabolic pathways
hpg01110  Biosynthesis of secondary metabolites
hpg01120  Microbial metabolism in diverse environments
hpg01130  Biosynthesis of antibiotics
hpg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPG27_79
   00620 Pyruvate metabolism
    HPG27_79
Enzymes [BR:hpg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HPG27_79
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Pyr_redox Lycopene_cycl PEX-1N FAD_binding_2 Thi4 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACI26849
UniProt: B5Z686
Position
complement(89526..90872)
Genome map
AA seq 448 aa AA seqDB search
MEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSIET
NYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKEIF
VGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYRKDWSTMNFAKLSENFVEEALKLK
PNNQVFLNFKVKKIEKRNDTYALISEDAEEVYAKFVLVNAGSYALPLAQSMGYGLDLGCL
PVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNKCW
LKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPIIGKRKFLKDAQKIIPS
LSLEDLEYAHGFGEVRPQVLDRTKRKLELGEKKICTHKGITFNMTPSPGATSCLQNALVD
SQEIAAYLGESFELERFYKDLSPEELEN
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgatgctgttattattggaggtggggtttcagggtgcgcgaccttttatact
ttgagcgaatacagctccttaaagcgcgtggctatcgtggaaaaatgctctaaattggct
caaatcagctccagcgctaaagctaattcacaaaccattcatgatggctctattgaaacg
aattacactcctgaaaaagctaaaaaagtgcgtttgagtgcttataaaaccagacaatac
gcgctcaataaaggcttgcaaaatgaagtgatttttgaaacccagaaaatggctataggc
gtgggcgatgaagaatgcgagttcatgaaaaagcgctatgaatcctttaaagaaatcttt
gtggggttagaagaatttgacaagcaaaagattaaagaattagagcctaatgtgatttta
ggggctaatggcatagacaggcatgaaaacattatcgggcatgggtataggaaggattgg
agcaccatgaattttgcgaagttgagcgaaaacttcgttgaagaagccttgaaattaaag
cctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaacgacact
tacgcactcatttcagaagacgctgaagaagtgtatgctaaattcgtgctagtcaatgct
ggctcttacgctttgcctttggctcagagcatgggctatggcttggatttagggtgcttg
cctgtggcgggcagcttttattttgtgccggatttattaaggggcaaggtttataccgtt
caaaaccccaaactcccttttgcagccgtacatggcgaccctgatgcggttattaaagga
aaaacacgaatcgggcctaccgctttaacgatgcctaaattagagcgcaacaaatgctgg
ctcaagggtattagcttggaattgttgaaaatggatttgaataaagatgtgtttaaaatc
gcatttgatttgatgagcgataaagaaatccgtaattatgtgtttaaaaacatggttttt
gaattgcctattattggtaaaaggaaatttttaaaagacgctcaaaaaatcatcccctct
cttagcctagaagatttagaatacgctcatggttttggcgaagtgcgcccgcaagtttta
gacagaaccaagcgaaagctggaattaggcgaaaaaaagatttgcacgcataaaggcatc
actttcaacatgaccccctctccaggcgcgacaagttgcttgcaaaacgcccttgtggat
tcccaagaaatcgctgcgtatttgggcgagagctttgaattggaacgcttttataaagat
ttatccccagaagaattggaaaattaa

DBGET integrated database retrieval system