KEGG   Helicobacter pylori G27: HPG27_967
Entry
HPG27_967         CDS       T00777                                 

Gene name
comB10-2
Definition
(GenBank) competence protein
  KO
K12048  ComB10 competence protein
Organism
hpg  Helicobacter pylori G27
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpg02044]
    HPG27_967 (comB10-2)
Secretion system [BR:hpg02044]
 Type IV secretion system
  DNA uptake competence system protein
   HPG27_967 (comB10-2)
SSDB
Motif
Pfam: TrbI Wzy_C
Other DBs
NCBI-ProteinID: ACI27720
UniProt: B5Z821
Position
1056088..1057323
AA seq 411 aa
MKKLLLLLEHKIIKIGLIIVIVLAGFFLFYEQEIKEKAVNVSQGKFPTSSYLFQAYEGIK
NKIDTINEVKPNDETKSVNENIEKTQKDLDDFNALVQKLPNLPKDFNKTLIKPQSPSFNY
NTANEEEKTRLVILASRISSQKETQPPTSIKNSVSNTKSKEKQELEKEYGSSGFKNFKRK
NVASSENKLLRTITADRMIPAILITPISSEIGGSKIIAQVESDIYATMGRAVLIPKGSRA
IGYYNSNNKIGEYRLEIAWNRIITPQGVNIILSDAKGADVKGYNGMIGTLHNKYWERYGI
PLSLSTLSNGLLIGLTSGLTEAMKNKRGGFNQNYFGDYMMMQMTRQTGISLNNIIAQIMR
DQIRIKPIITIREGSHIFISPNTDIWFPIPKNNEILAKFFNEEKEQNNDTK
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaaaaaacttcttttacttttagagcataaaatcataaaaattggcttaattattgtg
attgtattagctggtttttttcttttttacgaacaagaaatcaaagaaaaagctgttaat
gtttctcaaggtaaattccctacttcatcttatttgtttcaagcttacgaaggcattaag
aataaaatagatactatcaatgaagtgaaaccaaacgatgaaactaaaagcgttaatgag
aatatagaaaaaacacaaaaagatttagatgattttaatgctctagtgcaaaaattacca
aatttgcctaaggattttaataaaacgcttattaaaccacaaagtccatccttcaactac
aataccgctaatgaagaagaaaaaacccgccttgtgattttggcgtctcgtattagcagt
caaaaagaaacgcaacctccaacctctataaaaaatagtgtttctaacacaaaatccaaa
gaaaaacaagaacttgaaaaagaatacggctctagcggttttaaaaattttaaaagaaaa
aatgtagcgagcagtgaaaacaaacttttgagaacgattacagctgacagaatgatccca
gccattctgatcactcctattagcagtgaaataggggggagtaagataatcgctcaagtg
gagagtgatatatacgcaacgatgggtagagcggttttaatccccaaagggagtagagcc
ataggctattacaactctaataacaaaataggagaataccgcttagaaattgcttggaat
aggataatcacgccacaaggggttaatatcatactaagcgatgctaagggagctgatgtc
aagggctataacggcatgataggaacactccataacaaatattgggaacgctatggtatt
cctttatccttaagcaccttgtcaaatgggctactcataggtcttactagcggtcttacc
gaagcgatgaaaaacaaaaggggtggttttaaccaaaactattttggagattacatgatg
atgcaaatgacgaggcaaactggtatcagcctaaataacattatcgctcaaatcatgcga
gatcaaatcaggattaagcccattatcactattagagagggaagccatatttttattagt
cctaatacggatatttggtttcctatccctaaaaacaatgagatcttagcgaaatttttt
aatgaagaaaaggagcaaaacaatgatacaaaatag

DBGET integrated database retrieval system