KEGG   Helicobacter pylori G27: HPG27_974
Entry
HPG27_974         CDS       T00777                                 

Definition
(GenBank) cag island protein,DNA transfer protein (virD4-like)
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPG27_974
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpg02044]
    HPG27_974
Enzymes [BR:hpg01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     HPG27_974
Secretion system [BR:hpg02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HPG27_974
SSDB
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C DUF87 ART-PolyVal
Other DBs
NCBI-ProteinID: ACI27727
UniProt: B5Z828
Position
1060476..1062203
AA seq 575 aa
MREKFKTLRDKFKDKTSNLFHKLNSIQKDYYAKTLPKACKDVFTLGSSKSYPMTLNFNKG
FCVGLYKGLNSLKPTYYDAPLSTLIIAPPGSGKTAAVAVPNLLNVPSSCVVLDIKGELFD
LTAGYRQQVLKNKIFVFNPLGNDNTLKFNPFDKRIVEKLDFNRKRRLVDEVGNTIFAEDG
ANKDPHWTQQAKNLFVFYALYDLCVHNTSTFFEIASAPIKNYVPLINPQSRFYTELYECQ
SSDNGFIKENGRYIAKVENGVKKMKPNANVELLWYKQVAEQVYTDPENPKNYDGSVNHLE
KDDQGNIMMKEGMLDPIIRNEANKWAKANDKEFASIKSVYSRFMQVFTSYQVKSATDSMS
FEYEDLRVDNISLYIKIAQTDIDTLAPLIRILLESIAKNLLLKESKKFEERVYLFLDEFV
RFGKLPFLLEMPALSRSYGVVLIFITQSNALIEKYYGREDARIVNSTVAYKVIFKMDDLE
YAKQVSEEIGKMTRKTRSHSTEKGQLITGGTSSIGKEAWDLLSAQDIMNIDKDEVIVLVS
GHKAKPLKLKANYYFKNKELLSRINWEVKPNKEVF
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgagagaaaaattcaaaacattaagagataaatttaaggataaaaccagcaatttattc
cataagcttaatagcattcaaaaagattattacgctaaaactctccctaaggcttgcaaa
gatgtctttacgctaggttcttctaaaagttatcctatgaccttaaattttaacaaaggt
ttttgtgtgggactatataaaggtttaaattcgcttaagcctacttattatgatgctccg
ctttctactttaattatcgctcctcctggaagtggtaaaaccgcagctgtggctgtgcct
aatcttttaaatgtgcctagctcttgtgtggtgttagatattaaaggggagttgtttgat
ttaacggctggttacagacaacaagttctaaaaaataaaatttttgtatttaatccctta
ggaaatgataacacgcttaaattcaatccgtttgataaacgcattgtagaaaaattagat
tttaacagaaagcgaaggcttgtagatgaagtgggtaatactatttttgctgaagatggg
gcaaataaagaccctcattggacacagcaagctaaaaatttatttgtcttttacgctctt
tatgatttgtgtgtgcataacactagcaccttttttgaaattgcaagcgctcctataaaa
aattatgtccccttaatcaatccacaaagccgattttacactgaattatatgaatgtcaa
agtagcgataatggttttattaaagagaatgggcgttatatagctaaagtagaaaatggc
gttaaaaaaatgaaacctaatgccaatgtagaattgctatggtataaacaagtagccgaa
caagtctatactgacccagaaaatcctaaaaattatgatggatctgtgaatcatttagaa
aaagacgatcaaggcaatattatgatgaaagagggtatgttagatcctattattagaaac
gaagcgaacaaatgggctaaggcgaatgataaagagtttgcgagcattaaatcagtttat
agccgttttatgcaagtctttacaagctatcaagttaaaagcgctacagatagcatgagt
tttgaatacgaggatttaagggttgataatatttcactttatattaaaatcgctcaaaca
gatattgacacactcgcaccgcttatccgtatccttttggaaagtattgctaaaaatctt
ttattgaaagagagtaagaaatttgaagaaagggtttatctctttttagatgaatttgtg
cgttttggtaaattgccttttttattagaaatgccagcattaagtaggagctatggtgtg
gttttaatttttattacgcaatccaacgctcttattgaaaaatattatggtagagaagat
gcaagaattgttaatagcaccgtggcttacaaagtaattttcaaaatggatgatttagaa
tacgctaaacaagtgagcgaagaaatcggcaagatgaccagaaaaacacgaagccactct
acagaaaaaggacaactcattaccggagggacttctagtataggtaaagaggcgtgggac
ttattgagtgcgcaagatattatgaatattgataaagatgaagtgatcgttttagtaagc
ggccataaggctaaacccttaaaattaaaagcgaattattattttaaaaataaagaatta
ctctctcgtattaattgggaagtcaagcccaataaagaagtgttttga

DBGET integrated database retrieval system