KEGG   Helicobacter pylori Lithuania75: HPLT_00470Help
Entry
HPLT_00470        CDS       T01896                                 

Definition
(GenBank) Malate:quinone oxidoreductase (Malate dehydrogenase [acceptor]) (MQO)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00020  Citrate cycle (TCA cycle)
hph00620  Pyruvate metabolism
hph01100  Metabolic pathways
hph01110  Biosynthesis of secondary metabolites
hph01120  Microbial metabolism in diverse environments
hph01130  Biosynthesis of antibiotics
hph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPLT_00470
   00620 Pyruvate metabolism
    HPLT_00470
Enzymes [BR:hph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HPLT_00470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Lycopene_cycl Pyr_redox FAD_binding_2 Thi4 PEX-1N K_oxygenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ADU82539
UniProt: E8QRH9
Position
complement(82762..84114)
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYQKDWSTMNFAKLSENFVEEALK
LKPNNQVFLNFKVKKIEKRNDTYAVISEDAEEVYAKFVLVNAGSYALPLAQSMGYGLDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPIIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDRTKRKLELGEKKICTHKGITFNMTPSPGATSCLQNAL
VDSQEIAAYLGESFELERFYKDLSPEELEN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgctgttattattggaggtggggtttcagggtgcgcaaccttt
tatactttgagcgaatacagctctttaaagcgcgtggctatcgtggaaaaatgctctaaa
ttggctcaaatcagttccagtgctaaagctaattcgcaaaccattcatgatggctctatt
gaaacgaattacactcctgaaaaagctaaaaaagtgcgtttgagcgcttataaaaccaga
caatacgcgctcaataaaggtttgcaaaatgaagtgatttttgaaacccagaaaatggct
ataggcgtgggcgatgaagaatgcgagttcatgaaaaaacgctacgaatcctttaaagaa
atctttgtggggttagaagaatttgacaagcaaaagattaaagaattagagcctaatgtg
atcttaggggctaatggcatagacaggcatgaaaacattatcgggcatggttatcaaaaa
gattggagcaccatgaattttgcgaagttgagtgaaaacttcgtcgaagaagccctaaaa
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaac
gacacttacgccgtaatttcagaagacgctgaagaagtgtatgctaaattcgtgctggtc
aatgccggctcttacgctttgcctttggctcagagcatgggctatggcctagatttaggg
tgcttgcctgtggcgggtagcttttattttgtgccggatttattaaggggtaaggtttat
accgttcaaaaccccaaactcccttttgcagccgtgcatggcgaccctgatgctgtcatt
aaaggaaaaacacgaatcgggcctaccgctttaacgatgcctaaattagaacgcaacaaa
tgctggctcaagggcattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aagatcgcgtttgatttgatgagcgataaagaaatccgtaattatgtgtttaaaaacatg
gtttttgaattgcctattatcggtaaaaggaaatttttaaaagacgctcaaaaaatcatc
ccctctcttagcctagaagatttagaatacgctcatggttttggcgaagtgcgcccgcaa
gttttagacagaaccaagcgaaagctagaattaggtgaaaaaaagatttgcacccataaa
ggcatcactttcaacatgaccccctctccaggcgcgacgagttgcttgcaaaacgccctt
gtggattcccaagaaatcgctgcgtatttgggcgagagctttgaattagaacgcttttat
aaagatttatccccagaagaattggaaaattaa

DBGET integrated database retrieval system