KEGG   Helicobacter pylori Lithuania75: HPLT_00600Help
Entry
HPLT_00600        CDS       T01896                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00051  Fructose and mannose metabolism
hph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPLT_00600
Enzymes [BR:hph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPLT_00600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADU82565
UniProt: E8QMD8
Position
112721..113359
Genome map
AA seq 212 aa AA seqDB search
MINMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEVTIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctccatttca
gcacgcattggcaccaatcaatttgtgatcaacaaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggttttgcatgacaagatagattaccgctggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgct
tacgcacgccctccttatagtttggcgtattctttgcgccacaaccggttgctccctaga
gattatttagggtatcgttctttgggcgaagaagtaacgatttttaaccccaaagattat
gacagctggcaagaaagagcggatacagaaattttacgccaattacaagagagcaaaaaa
tattttgttttcattaaagggtgtgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatg
gattattgctataatgacgatccacgattgagcgtgtaa

DBGET integrated database retrieval system