KEGG   Helicobacter pylori Lithuania75: HPLT_03225Help
Entry
HPLT_03225        CDS       T01896                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00040  Pentose and glucuronate interconversions
hph00052  Galactose metabolism
hph00500  Starch and sucrose metabolism
hph00520  Amino sugar and nucleotide sugar metabolism
hph01100  Metabolic pathways
hph01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPLT_03225
   00052 Galactose metabolism
    HPLT_03225
   00500 Starch and sucrose metabolism
    HPLT_03225
   00520 Amino sugar and nucleotide sugar metabolism
    HPLT_03225
Enzymes [BR:hph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPLT_03225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 P53_C Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ADU83071
UniProt: E8QPD9
Structure
PDB: 

Position
646476..647297
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMASLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR
KHIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctatggcacgcgctttttaccgatcact
aaaaccattcctaaagaaatgctgcccattgtagataagcctttaatccaatatgctgta
gaagaagcgatggaagcgggctgtgaagtgatggcgatcgttacaggaaggaataaacga
agcttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaatattatagagaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcctagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttatgcataagtcatgatcaccctagc
gtgctaaagcaaatggcttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgttagaagaagtttcaaaatacggcgtgattaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaaatcaagaagacgccccaagcaat
ctagccgtgatagggcgctacattctaaccccagatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttacgcactcaagccaaaaga
aagcacatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system