KEGG   Helicobacter pylori Lithuania75: HPLT_03445Help
Entry
HPLT_03445        CDS       T01896                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00071  Fatty acid degradation
hph00072  Synthesis and degradation of ketone bodies
hph00280  Valine, leucine and isoleucine degradation
hph00310  Lysine degradation
hph00362  Benzoate degradation
hph00380  Tryptophan metabolism
hph00620  Pyruvate metabolism
hph00630  Glyoxylate and dicarboxylate metabolism
hph00640  Propanoate metabolism
hph00650  Butanoate metabolism
hph00900  Terpenoid backbone biosynthesis
hph01100  Metabolic pathways
hph01110  Biosynthesis of secondary metabolites
hph01120  Microbial metabolism in diverse environments
hph01130  Biosynthesis of antibiotics
hph01200  Carbon metabolism
hph01212  Fatty acid metabolism
hph02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPLT_03445
   00630 Glyoxylate and dicarboxylate metabolism
    HPLT_03445
   00640 Propanoate metabolism
    HPLT_03445
   00650 Butanoate metabolism
    HPLT_03445
  Lipid metabolism
   00071 Fatty acid degradation
    HPLT_03445
   00072 Synthesis and degradation of ketone bodies
    HPLT_03445
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPLT_03445
   00310 Lysine degradation
    HPLT_03445
   00380 Tryptophan metabolism
    HPLT_03445
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPLT_03445
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPLT_03445
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPLT_03445
Enzymes [BR:hph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPLT_03445
Exosome [BR:hph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPLT_03445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADU83111
UniProt: E8QPH9
Position
695370..696545
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAIGSFLGSLKSVGAREMGVSVLKDALNASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSK
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREDQDNFAL
QSQLKARAAINAKKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSTKKAQALGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctatagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgttagcgtgcttaaagacgctttgaatgcg
agcggccttaagcctagcgatgtggattctgtcattttgggcaatgttttaggcgctggt
ttgggtcaaaatatcgccagacagatccaactagacgctggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcaaa
gcaccctatttgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagatcaagataatttcgcgctc
cagtcgcaactcaaagcgagagccgccattaatgcaaagaaattccaagaagaaatcacg
cctattgaaatagcaaataaaaaaggcgtggtggtttttaaagaagacgaataccctagg
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcact
aaaaaagcgcaagcattggggttaaaaaccatggccactatcaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagtattgcgattaaaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagcttttgccgca
caaagtatcgccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggttgcgcgtcattgtgtgtgggtggc
gggcaaggtctttctgtggtagtggaacaaaaataa

DBGET integrated database retrieval system