KEGG   Helicobacter pylori Lithuania75: HPLT_06125Help
Entry
HPLT_06125        CDS       T01896                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00860  Porphyrin and chlorophyll metabolism
hph01100  Metabolic pathways
hph01110  Biosynthesis of secondary metabolites
hph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPLT_06125 (hemD)
Enzymes [BR:hph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HPLT_06125 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peptidase_S41
Motif
Other DBs
NCBI-ProteinID: ADU83615
UniProt: E8QQY3
Position
1228885..1229565
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNELCYYPLELDPTPFNALIFTSKNAVFSLLETLKNNPKLK
TLQNIPAYALSEPTAKTLQDHHFKTAFIGEKAHGKEFVQEILPLLKGKSVLYLRVKEIAS
SLDTILLEHGINFQQAVVYENKLKHLTLSEQNALKPKEKSVLIFTAISHAKAFLHYFEFL
ENYTAISIGNTTAHYLQEKGIPSYIAKKPSLEACLELALSLRIKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattgtgctactatcccttagaattagatccaacccctttcaacgcccttattttc
acttctaaaaatgcggtgttttccttgctagaaaccctaaaaaacaacccaaaactcaaa
acgttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaactttacaagat
caccattttaaaaccgcctttataggggaaaaagcccatggcaaagagttcgttcaagaa
atccttcctttattgaaaggaaaaagcgttttgtatctcagggtaaaagaaattgcctct
tctttagatactattcttttagagcatggcatcaatttccaacaagccgttgtttatgaa
aacaagctcaaacatttgactttaagcgagcaaaacgccctaaaacccaaagaaaagagc
gttctcattttcaccgccataagccatgcaaaagcctttttgcactattttgaattttta
gaaaactacaccgctatcagcattggcaacacgaccgctcattatttacaagagaaaggc
attccaagctatattgccaaaaagccctccttagaagcgtgtttagaactggctttaagt
ttgagaattaaggaatgttaa

DBGET integrated database retrieval system