KEGG   Helicobacter pylori Lithuania75: HPLT_06425Help
Entry
HPLT_06425        CDS       T01896                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hph01100  Metabolic pathways
hph01110  Biosynthesis of secondary metabolites
hph01130  Biosynthesis of antibiotics
hph01230  Biosynthesis of amino acids
Module
hph_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hph00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPLT_06425
Enzymes [BR:hph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPLT_06425
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPLT_06425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADU83675
UniProt: E8QR49
Position
complement(1283673..1285031)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSDLKKNHTLPINITPSDRDFKKALLETKTSFILECKKASPSKGL
IRKDFDLLKIAKTYEKFASCISVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIERLLKLQYDIIGI
NNRDLHTLKTDIFHTLELRPLLPKDALIISESGIYSHVQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKFDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVISVMS
AKDLTPKTKEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNLQKALKVK
ALGLDFNSGLEISPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtctctgatctcaaa
aaaaatcacactttaccgataaacataaccccaagcgacagggattttaaaaaagcgtta
ctagaaacaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggtttg
ataagaaaagattttgatctgttaaaaatagccaagacttatgaaaaattcgcctcttgc
atttcggttttagccgattctaaatattttttaggctcttatgaaaacattaagatcgtt
tcgcagcattccaccaagcccattttatgcaaagattttatcattgatgcttttcaaatc
aaactcgctagaatgatgggggctaatgcagtgcttttaatgttaagcgtgttagatgat
aaaaattacttagagcttttcaacctcgctaaatccttaaacatgagcgtgctgactgaa
gtttccaaccagcaagaaattgaacgcttgctcaaactccaatacgacattataggcatc
aataacagggatttacacaccttaaaaaccgatatttttcacacgctagaattacgcccc
ttattgcctaaagacgcgctcattatcagtgagtccggtatttattcgcatgtgcaaatc
aaagccctagccccttatgtgaacggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgcattaaattgattttaggcgaaaataaagtgtgcgggcttaca
aggattaaagacgctaaagccgtttataaaaaccattttatttatgggggtttgattttt
gaaaaatcttcgccccgatacatcaagcctaaagaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataagattaaaaaaattcaaaagatc
gctaaaaagtttgatttaaaagcggtgcagctttatggctattcgcaaaaagaaatcgct
caattaaaaaaatcgctccctaaaacttgcgcgatctggcaagtaataagcgtgatgagc
gctaaagatttaacgcctaaaactaaagaggcctctctaatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggcattttagaaaatgtcaaaacg
cctttcatgttagctggcgggcttaatttggataatcttcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattccggtttagaaataagccctgggattaaaaataaggat
aaaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system