KEGG   Helicobacter pylori Lithuania75: HPLT_07420Help
Entry
HPLT_07420        CDS       T01896                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hph  Helicobacter pylori Lithuania75
Brite
KEGG Orthology (KO) [BR:hph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HPLT_07420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RnlB_antitoxin DUF1240 NnrS
Motif
Other DBs
NCBI-ProteinID: ADU83869
UniProt: E8QMQ2
Position
complement(1466918..1468519)
Genome map
AA seq 533 aa AA seqDB search
MEIKNIKEFEKASKKLQKDTLKIALALLFLIGAALLALIFGQANSKGLLLIFAAVIGGYM
AMNIGANDVSNNVGPAVGSKAISMGGAILIAAICEMLGAIIAGGEVVSTIKGRIVSPEFI
NDAHVFINVMLASLLSGALWLHVATLIGAPVSTSHSVVGGIMGAGMAAAGMAAVNWHFLS
GIVASWVISPLMGALIAMFFLMLIKKTIAYKEDKKSAALKVVPYLVALMSLTFSWYLMVK
VLKRLYAVGFEIQLACGCILALLIFILFKRFVLKKAPQLENSHESINELFNVPLIFAAAL
LSFAHGANDVANAIGPLAAISQTLEDANSPIGNTLSSVPLWIMVVGAAGIALGLSLYGPK
LIKTVGSEITELDKMQAFCIALSAVITVLLASQLGLPVSSTHIVVGAVFGVGFLRERLRE
QSRRRFARIRDNIVAAHFGEDLEEIEGFLERFDKANLKEKSLMLESLKKSKNTAIALELK
KKEKKSLKKVYKEEVIKRSILKKIVTAWLVTVPVSALLGALLFVALGFIEKYF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaacatcaaagagtttgaaaaagcttccaaaaaactccaaaaagacact
ttaaagatcgctctcgctcttttgtttctcattggcgctgctttgctcgctcttattttt
gggcaggctaattctaagggattgttgcttatttttgcggctgtgattggggggtatatg
gcgatgaatattggcgcgaatgatgtgtctaataatgtcggccctgccgtaggctctaaa
gccattagcatgggcggggcgattttgatcgctgcgatttgtgaaatgcttggagcgatc
attgctgggggggaagtggtttctacgattaagggccgtatcgtttcgcctgaatttatt
aatgatgcgcatgttttcattaatgtcatgttggctagcttactcagtggggcgttgtgg
ttgcatgtagcgactttaattggcgctcctgtttccacttcacactctgtggtggggggg
attatgggggctggaatggcagcagctggaatggcagctgtcaattggcattttttatca
ggcattgtggccagttgggtaatctcgcctttaatgggggctttgatagccatgtttttt
ttaatgctcattaaaaagactatcgcttataaagaagataaaaagagcgcggctttaaag
gtcgtgccttatttggtagcgttgatgagcttaacattcagctggtatttgatggttaag
gttttaaaacgcctctatgcggtgggttttgaaatccaactggcttgcggctgtatcctt
gcgcttttaatctttatcctttttaaaagatttgtgttaaagaaagccccgcaattagaa
aacagccatgaaagcatcaatgagcttttcaatgtccctttgatttttgccgctgcgctt
ttaagctttgcgcatggggctaatgacgtggctaacgctataggcccactagcggccatc
agtcaaactttagaagatgcaaatagccctatagggaatactttaagctctgtgccgttg
tggattatggtagtaggggcagctgggattgctttaggcttgagtttgtatgggccaaag
ctcattaaaacggtggggtctgaaatcacagaattagacaaaatgcaagctttttgcatc
gcactttctgcagtcatcaccgtgcttttagcctctcaattaggcttgcccgtaagctct
acgcatattgtggtgggtgcggtgtttggggtgggctttttaagagagcgcttaagggag
caatccagaaggcgttttgctaggatcagagacaacattgtagccgcgcactttggggaa
gatttagaagaaattgaaggttttttagagcgctttgataaagccaatttgaaagaaaaa
tcgctcatgctagagagcttgaagaaaagcaagaacaccgccatcgctttggaattgaaa
aagaaagaaaaaaagtcgcttaaaaaagtgtataaagaagaggtgatcaaacgctccatt
ttaaaaaagattgttaccgcttggttggtaaccgtgccggtttctgcgcttttgggggcg
cttttgtttgtggctcttggttttatagaaaagtatttctag

DBGET integrated database retrieval system