KEGG   Helicobacter pylori 908: hp908_0172Help
Entry
hp908_0172        CDS       T01893                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00860  Porphyrin and chlorophyll metabolism
hpi01100  Metabolic pathways
hpi01110  Biosynthesis of secondary metabolites
hpi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    hp908_0172 (hemB)
Enzymes [BR:hpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     hp908_0172 (hemB)
Exosome [BR:hpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   hp908_0172 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADN79303
UniProt: E1S6S5
Position
complement(163389..164360)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMLRETHLNINDFIAPLFVIESDSYIKNEISSMPGVYQMSIEPLL
KECEELVGLGIKAVLLFGIPKHKDATGSHALNKDHIVAKATKEVKKRFKDLIVIADLCFC
EYTDHGHCGILENDSVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLDKA
GYFHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaatttaagagcgatgttaagagaa
acgcatttaaatatcaatgatttcatcgctcccttatttgtcatagaaagcgatagttat
attaaaaacgaaatcagctccatgcccggcgtgtatcaaatgagtatagagcctctttta
aaagaatgcgaagaattagtgggtttaggcataaaagccgttttactgtttggcattcct
aaacataaggacgctacaggaagccatgcgttaaataaggatcacattgtcgcaaaagcc
accaaagaggttaaaaaacgatttaaggatttaatcgttatagcggatttgtgtttttgc
gaatacaccgaccatgggcattgcgggattttagaaaacgattctgtgtctaacgataaa
acgctagagattttaaatcttcaagggcttattttggctgaaagcggtgtggatattcta
gccccaagcaacatgatggatggcaatgttttaagcttgaggaaaacgctagataaggcc
gggtattttcacacgcccatcatgagctattccactaaatttgcgagcagttattatggg
ccttttagagatgtagctaattctgcaccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaaccaaaaagaagcgcttttagaaagcttggaagatgaaaaacagggtgcg
gatattttaatggtgaagccggctttagcgtatttggatattgttaaagagattagagat
cacactttgctccctttagcgctctataacgtgagtggggaatacgccatgctcaaactc
gcgcaaaaacacaacctgatcaactatgaaagcgttctgttagaaacgatgacttgcttt
aaaagagcgggagcggatatgattattagctaccatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system