KEGG   Helicobacter pylori 908: hp908_0816Help
Entry
hp908_0816        CDS       T01893                                 

Gene name
ribA
Definition
(GenBank) GTP cyclo hydrolaseII
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00740  Riboflavin metabolism
hpi00790  Folate biosynthesis
hpi01100  Metabolic pathways
hpi01110  Biosynthesis of secondary metabolites
hpi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hpi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    hp908_0816 (ribA)
   00790 Folate biosynthesis
    hp908_0816 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    hp908_0816 (ribA)
Enzymes [BR:hpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     hp908_0816 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ADN79942
UniProt: E1S8W2
Structure
PDB: 

Position
complement(797608..798186)
Genome map
AA seq 192 aa AA seqDB search
MKRLEVSNQAKLPTQFGEFCIQCFREKGSNGSKDHLVIFTPNFPQNPLVRLHSECLTGDA
LGSQKCDCGGALQMALERISKEGGLVIYLRQEGRGIGLFNKVNAYALQDKGYDTIQANEM
IGFKDDERDYSVAGEILEYYRIKKMRLLTNNPLKIAALEKYAEVTRESLIVCANEHNQGY
LEVKKLKMGHLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgattagaagtttctaaccaagccaaattacccactcaatttggggagttttgt
atccagtgttttagagaaaagggttctaatggatctaaagatcatttagtcattttcacc
cctaattttcctcaaaaccccttagtgcgcttgcattcagaatgcttaacgggtgatgct
ctaggctctcaaaaatgcgattgcggaggggcgttgcaaatggcgttagaaaggatttct
aaagaaggggggctagtgatttatttgcgccaagaagggcgtgggatagggctatttaat
aaagtcaatgcctacgccttacaagataagggctatgataccattcaagccaatgaaatg
atagggtttaaagacgatgaaagggattatagtgttgcgggtgagattttagaatattac
cgcattaaaaaaatgcgcttgctcacgaataaccctctaaaaatcgccgctttagaaaaa
tacgctgaggtaacaagagagagcttgatcgtgtgtgctaatgagcacaatcaagggtat
ttggaagtcaaaaagctcaaaatggggcatttattgtga

DBGET integrated database retrieval system