KEGG   Helicobacter pylori 908: hp908_1104Help
Entry
hp908_1104        CDS       T01893                                 

Definition
(GenBank) Pyruvate:ferredoxin oxido reductase delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00010  Glycolysis / Gluconeogenesis
hpi00020  Citrate cycle (TCA cycle)
hpi00620  Pyruvate metabolism
hpi00640  Propanoate metabolism
hpi00650  Butanoate metabolism
hpi00680  Methane metabolism
hpi01100  Metabolic pathways
hpi01120  Microbial metabolism in diverse environments
hpi01130  Biosynthesis of antibiotics
hpi01200  Carbon metabolism
Module
hpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp908_1104
   00020 Citrate cycle (TCA cycle)
    hp908_1104
   00620 Pyruvate metabolism
    hp908_1104
   00640 Propanoate metabolism
    hp908_1104
   00650 Butanoate metabolism
    hp908_1104
  Energy metabolism
   00680 Methane metabolism
    hp908_1104
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    hp908_1104
Enzymes [BR:hpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     hp908_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_17 Fer4_7 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_18 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADN80227
UniProt: E1S9P7
Position
1077061..1077453
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVTKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaagaacgcg
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagttacttcacc
acttcagtggctcattggcgcgtgactaagcctgtgcataacaataatatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgccattctttcaagagagggcaaatta
aagggcgtggattattctcattgtaagggctgtggcgtgtgcgtggatgtctgccccact
aaccctaaatccctatggatgtttgaagaacaaattgagcctgccaccgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system