KEGG   Helicobacter pylori 908: hp908_1275Help
Entry
hp908_1275        CDS       T01893                                 

Definition
(GenBank) Phospho mannomutase/Phospho glucomutase/Phospho glucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpi  Helicobacter pylori 908
Pathway
hpi00010  Glycolysis / Gluconeogenesis
hpi00030  Pentose phosphate pathway
hpi00051  Fructose and mannose metabolism
hpi00052  Galactose metabolism
hpi00230  Purine metabolism
hpi00500  Starch and sucrose metabolism
hpi00520  Amino sugar and nucleotide sugar metabolism
hpi00521  Streptomycin biosynthesis
hpi01100  Metabolic pathways
hpi01110  Biosynthesis of secondary metabolites
hpi01120  Microbial metabolism in diverse environments
hpi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp908_1275
   00030 Pentose phosphate pathway
    hp908_1275
   00051 Fructose and mannose metabolism
    hp908_1275
   00052 Galactose metabolism
    hp908_1275
   00500 Starch and sucrose metabolism
    hp908_1275
   00520 Amino sugar and nucleotide sugar metabolism
    hp908_1275
  Nucleotide metabolism
   00230 Purine metabolism
    hp908_1275
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    hp908_1275
Enzymes [BR:hpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     hp908_1275
    5.4.2.8  phosphomannomutase
     hp908_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADN80396
UniProt: E1SAC5
Position
1247172..1248548
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDENTAFSIGVELGKIMREYDKSVFVGHDARVHGRFLFEALS
AGLQSSSLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEKKPLKETPKKVNALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMRENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPTIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETIALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgacattaggggcatttaccccaccactttagat
gaaaatacggcttttagtatcggcgtggagttggggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcagcctgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatcaatggcattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaggctttaaaagacacgcttttaaatgctaaacatgaaaaa
aaacccctaaaagaaacgccaaagaaagtcaatgccctagaagcgtatcatcgctatttg
atcaaggattttaagcatttaaaaaatcttaaatataaaatcgccctggattttggtaat
ggcgtgggagcgttaggattagagccgattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcgagaaaacgctattttgataggctttgctttt
gatggcgatgcggataggattgcgatgctaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccttttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgattaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaagctcaaagaaactaatgcacattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tacgcatgtttaagggctttggagttattgcttgaacaaagtccaagcgacttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcacaacttacaagaagcgcttaaaaacccgccaagccat
ttccctacaatcaaagaaatcatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaatagcgttagaatataaaagggcgttgctcaatttgttagagaagtag

DBGET integrated database retrieval system