KEGG   Haemophilus pittmaniae: NCTC13334_00132Help
Entry
NCTC13334_00132   CDS       T06001                                 

Gene name
gstB
Definition
(GenBank) Glutathione S-transferase GstB
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hpit  Haemophilus pittmaniae
Pathway
hpit00480  Glutathione metabolism
hpit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCTC13334_00132 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpit02000]
    NCTC13334_00132 (gstB)
Enzymes [BR:hpit01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NCTC13334_00132 (gstB)
Transporters [BR:hpit02000]
 Other transporters
  Pores ion channels [TC:1]
   NCTC13334_00132 (gstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_3 GST_N_2 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: SNV57370
Position
1:complement(143419..144036)
Genome map
AA seq 205 aa AA seqDB search
MITLYNLKQSRSQRIAWLLEALNLPYNVQNFERDPVTKLAPKELHNIHPLGKSPLIKDDE
TIVAESGAIVEYILARYGNGKLHPDINHADYVNYLQWVHYAEGSAMPAMIMKYMTQSEAM
KPFCDAQFNLHLNYIENSLHGKTWFLGKELSGADIMMSFPLQFALMLVPKGQFPNIERFV
AQVESNEYYRKACERVGELELKKLA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattaccctatataaccttaaacagtctcgttcacaacgtatcgcatggttactggaa
gctttgaatctaccatataacgtacaaaattttgagcgagatcccgtgactaaattagcg
cctaaagagctacacaatattcacccacttggtaaatcgccactgattaaagacgatgaa
accatcgttgcagaaagcggtgcgattgttgaatatattctagctcgttatggtaacggc
aagttacatcctgatatcaaccatgcagactacgtgaactatttgcaatgggtgcattac
gcagaaggttccgctatgccagccatgataatgaaatacatgactcagtcagaagccatg
aagccattttgcgatgctcaatttaacctacacctcaactatatagaaaatagcctacat
ggtaaaacctggtttttaggcaaagagttaagcggtgcagatatcatgatgtctttccct
ctacaatttgctctcatgctcgtacctaaaggtcaatttcctaacattgaacgtttcgtt
gcccaagtggaaagcaacgaatattaccgtaaagcctgtgagcgcgttggtgaattagaa
ttaaaaaaattggcataa

DBGET integrated database retrieval system