KEGG   Helicobacter pylori J99: jhp_0409Help
Entry
jhp_0409          CDS       T00020                                 

Definition
(GenBank) putative Short chain dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
hpj  Helicobacter pylori J99
Pathway
hpj00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hpj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    jhp_0409
Enzymes [BR:hpj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     jhp_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AAD05988
UniProt: Q9ZM14
Position
complement(436090..436878)
Genome map
AA seq 262 aa AA seqDB search
MNGSNHMKNKTLVISGATRGIGKAILYRFAQSGVNIAFTYNKNVEEANKIIEDVEQKYSI
KAKAYPLNVLEPEQYTELFKQVDADFDRVDFFISNAIIYGRSVVGGFAPFMRLKPKGLNN
IYTATVLAFVVGAQEAAKRMQKIGGGAIVSLSSTGNLVYMPNYAGHGNSKNAVETMVKYA
AVDLGEFNIRVNAVSGGPIDTDALKAFPDYVEIKEKVEEQSPLKRMGNPNDLAGAAYFLC
DETQSGWLTGQTIVVDGGTTFK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatggttccaatcacatgaaaaataaaaccctagtgattagcggtgcgacgagaggg
attggcaaggcgatattgtatcgtttcgctcaaagcggcgtgaatatcgctttcacttac
aataaaaatgttgaagaagcgaataaaattatagaagatgtggagcaaaaatattccatt
aaagccaaagcctacccccttaatgttttagagcctgagcaatacacagagctttttaag
caagttgacgctgattttgacagagtggatttttttatttctaacgctattatttatggg
cgctctgtcgtggggggatttgcgccgtttatgcgattaaaacctaaggggttaaacaac
atttacacagccactgtgttagcgtttgtggtaggggctcaagaagcggcaaaacgcatg
caaaaaataggcggtggggcgatcgtgagcttaagctctaccgggaatttggtctatatg
cctaattacgccgggcatggcaattccaaaaacgccgtagaaaccatggtcaaatacgct
gccgtggatttaggcgaatttaacattagagtgaatgcggttagtggcgggcctattgat
acggacgctttgaaagccttccctgattatgtagaaattaaagaaaaagtagaagagcaa
tcgcccctaaaacgcatgggcaatcctaacgatctagccggggcggcttattttttatgc
gatgagacccaaagcggttggcttacagggcaaacgatcgttgtggatggtgggactact
tttaaataa

DBGET integrated database retrieval system