KEGG   Helicobacter pylori J99: jhp_0452Help
Entry
jhp_0452          CDS       T00020                                 

Gene name
dnaN
Definition
(GenBank) DNA POLYMERASE III, BETA CHAIN
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
hpj  Helicobacter pylori J99
Pathway
hpj00230  Purine metabolism
hpj00240  Pyrimidine metabolism
hpj01100  Metabolic pathways
hpj03030  DNA replication
hpj03430  Mismatch repair
hpj03440  Homologous recombination
Module
hpj_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hpj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    jhp_0452 (dnaN)
   00240 Pyrimidine metabolism
    jhp_0452 (dnaN)
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    jhp_0452 (dnaN)
   03430 Mismatch repair
    jhp_0452 (dnaN)
   03440 Homologous recombination
    jhp_0452 (dnaN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hpj03032]
    jhp_0452 (dnaN)
   03400 DNA repair and recombination proteins [BR:hpj03400]
    jhp_0452 (dnaN)
Enzymes [BR:hpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     jhp_0452 (dnaN)
DNA replication proteins [BR:hpj03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     jhp_0452 (dnaN)
DNA repair and recombination proteins [BR:hpj03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     jhp_0452 (dnaN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_3 DNA_pol3_beta_2 AbiEi_3
Motif
Other DBs
NCBI-ProteinID: AAD06030
UniProt: Q9ZLX4
Structure
PDB: 

Position
489047..490171
Genome map
AA seq 374 aa AA seqDB search
MKISVSKNDLENTLRYLQAFLDKKDASSIASHIHLEVIKEKLFLKASDSDIGLKSYISTQ
STDKEGVGTINGKKFLDIISCLKDSNIVLETKDDSLVIKQNKSSFKLPMFDADEFPEFPV
IDPKVSLEINAPFLVDAFKKIAPVIEQTSHKRELAGVLMQFNQKHQTLSVVGTDTKRLSY
TQLEKISIHSTEEDISCILPKRALLEILKLFYENFSFKSDGMLAVVENETHAFFTKLIDG
NYPDYQKILPKEYTSSFTLGKEEFKEGIKLCSSLSSTIKLTLEKNNALFESLDSEHSETA
KTSVEIEKGLDIEKAFHLGVNAKFFLEALNALGTTQFVLKCNEPSSPFLIQEPLDEKQSH
LNAKISTLMMPITL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcagtgttagtaaaaacgatttagaaaacactttgcgctacttgcaagctttt
ttggataaaaaggacgcttcctctatcgcttcacacatccatttagaagtcattaaagaa
aagctctttttaaaagccagcgattcagatattggactaaaaagctatatttctacgcaa
tctaccgataaagagggcgtaggcacgatcaacgggaagaagtttttagatattatctca
tgtttgaaagactctaatattgttttagagactaaagatgacagcttggtgatcaaacaa
aataaaagctctttcaaactccccatgtttgacgctgatgagttccctgaattccctgtt
attgatccaaaagtgagtttagaaatcaatgccccctttttggtggatgcgtttaaaaag
atcgctcctgtgattgagcaaactagccataaaagggaattagccggtgttttaatgcaa
ttcaatcaaaaacaccaaaccctttcagtggtaggcacggataccaagcggctctcttac
acgcagttagaaaaaatctctatccattccaccgaagaagacatctcttgcattttgcct
aaaagggctttattggaaatccttaaacttttttatgaaaatttcagttttaaaagcgac
ggcatgttagcggtggttgaaaacgaaacgcacgcttttttcaccaagctcattgatggg
aattaccctgattatcaaaaaatcctccctaaagaatacacttcttctttcactttaggc
aaggaagaatttaaagagggcattaagttgtgcagttctttaagctccaccattaagctc
actttagaaaaaaacaacgctttgtttgaatctttggattctgagcatagcgaaaccgcc
aaaacctctgttgagattgaaaaaggtttggatattgaaaaagcctttcatttgggcgtg
aacgcaaaatttttccttgaagccttaaacgctttagggacaacgcaatttgttttaaaa
tgcaatgagccttcttcgccttttttgattcaagaacctcttgatgaaaagcaaagccac
ttgaacgctaaaatttccactttgatgatgccaatcacactataa

DBGET integrated database retrieval system