KEGG   Helicobacter pylori J99: jhp_1112Help
Entry
jhp_1112          CDS       T00020                                 

Definition
(GenBank) CARBONIC ANHYDRASE
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
hpj  Helicobacter pylori J99
Pathway
hpj00910  Nitrogen metabolism
hpj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    jhp_1112
Enzymes [BR:hpj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     jhp_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-ProteinID: AAD06693
UniProt: Q9ZK30
Structure
PDB: 

Position
1236741..1237484
Genome map
AA seq 247 aa AA seqDB search
MKKTFLIALALTASLIGAENTKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYY
HTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLIN
NKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNLKEVALDAFLPKS
INYYHFNGSLTAPPCTEGVAWFVIEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVII
KSSAETR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacttttttgatcgctttagcgcttacggcttctcttataggcgctgaaaac
accaaatgggattataaaaataaagaaaatggcccgcaccgctgggacaaattgcacaaa
gattttgaagtgtgcaaaagcggtaaaagccaatcgcccatcaacattgagcattactac
cacacgcaagataaagccgatttgcaattcaaatacgccgcttctaaacctaaagcggtc
tttttcacccaccatactttaaaggcttcgtttgagccgactaaccacatcaattataga
gggcatgactatgtgttggataatgtgcatttccacgcccctatggagtttttaatcaat
aataaaaccaggcctttgagcgcgcatttcgtgcataaagacgctaaagggcgtttgttg
gtgttagcgattggttttgaagaagggaaagaaaaccccaaccttgatcctattttagaa
ggcattcaaaagaaacaaaatcttaaagaggtggctttagacgctttcttgcctaaaagc
atcaattactaccattttaacggctctctcaccgctcctccttgcacagagggggtggca
tggtttgtcatagaagaacctttggaagtttctgccaaacaattggctgaaatcaaaaaa
cgcatgaaaaattcgcccaaccaacgccccgtccagcctgactacaacaccgtgatcatt
aaaagctcggctgagacccgctaa

DBGET integrated database retrieval system