KEGG   Halanaerobium praevalens: Hprae_0368Help
Entry
Hprae_0368        CDS       T01941                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
hpk  Halanaerobium praevalens
Pathway
hpk00520  Amino sugar and nucleotide sugar metabolism
hpk01100  Metabolic pathways
hpk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Hprae_0368
Enzymes [BR:hpk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Hprae_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ADO76524
UniProt: E3DNI6
Position
424691..425863
Genome map
AA seq 390 aa AA seqDB search
MSYYIKSKKIYKEDEIILDHALKIEGEKISGFVKSSELSSNDIVVDCGNKIIIPALIDLH
IHGAVGKDVMDGDYESLNDISKYLASIGVSRFLATTLTAPISKIENALKNIRESQKRGLA
GAKIIGTYLEGPYLSKEKKGAHPEEYLKEPNIKEIKKMIDISGNNIKILALAPEKNESQK
VIKFLCDKGIIAALAHTNADYSVIEESVKNGAFLATHTFNGMKGLHHRNPGAIGGIMAFD
EIYSELIADKIHVHPAVMKILYKVKGLEKIALISDCMRAGGIEDGEYKLGEIDVNVKNAT
ARTRSGSLAGSTLKIKDALLNIKEAVDIELFEAVKMASLVPAKILGLDSELGSIKKFKKA
DITVIDSEMNIYLTAVDGKIVYKNKLEVLN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagctattatattaagagcaaaaaaatatataaagaagatgaaattatattagatcac
gctttaaaaattgagggtgaaaaaatatctggatttgttaaaagttctgaactgagttca
aatgatatagtagtagattgtggaaataaaataattattcctgctctgattgatcttcat
attcatggtgcagtaggaaaagatgtgatggatggagattatgaatcgttaaatgatatt
tcaaagtatttagcaagtattggagttagtagatttttagctacgactttgactgcaccc
atatctaaaattgaaaatgctttaaaaaatataagggaatctcagaaaagaggtttagca
ggagctaaaattattgggacatatttagaaggtccttatttaagcaaagaaaaaaaagga
gctcatccagaagaatatttaaaagaaccaaatatcaaagaaattaaaaaaatgattgat
atttctggaaataatatcaaaatattagctttagcacctgaaaaaaatgaatcgcaaaaa
gttattaaatttctgtgtgataaaggaataatagccgcgttagctcatactaatgccgat
tactcggtaatcgaagaatcagtaaaaaatggagcttttttagcaactcacacctttaat
ggaatgaaaggcttgcatcaccgtaatccaggagctatcggtggaattatggcttttgat
gaaatttatagtgaactaattgcagataagattcatgttcatcctgcagtaatgaaaata
ctttataaagtaaagggtttagaaaaaattgctttaataagtgactgtatgagagcaggt
gggattgaagatggagaatataaattaggtgagattgatgttaatgtgaaaaatgcgact
gcaagaactagaagtggttctttagctggcagtactttaaaaattaaagatgcactatta
aatattaaagaagctgtagatattgaactttttgaagcggttaagatggcttctttagtc
ccggcaaagattttaggtttagatagtgagttaggaagtattaaaaaatttaaaaaagca
gatattacagtaatagactcagagatgaatatttatctgacagctgttgatggtaaaatt
gtttataaaaataaattagaagttttaaattaa

DBGET integrated database retrieval system