KEGG   Halanaerobium praevalens: Hprae_0525Help
Entry
Hprae_0525        CDS       T01941                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
hpk  Halanaerobium praevalens
Pathway
hpk00030  Pentose phosphate pathway
hpk00480  Glutathione metabolism
hpk01100  Metabolic pathways
hpk01110  Biosynthesis of secondary metabolites
hpk01120  Microbial metabolism in diverse environments
hpk01130  Biosynthesis of antibiotics
hpk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hprae_0525
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Hprae_0525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpk04147]
    Hprae_0525
Enzymes [BR:hpk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Hprae_0525
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Hprae_0525
Exosome [BR:hpk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Hprae_0525
  Exosomal proteins of colorectal cancer cells
   Hprae_0525
  Exosomal proteins of bladder cancer cells
   Hprae_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Nrap_D5
Motif
Other DBs
NCBI-ProteinID: ADO76679
UniProt: E3DPC8
Position
complement(600484..602019)
Genome map
AA seq 511 aa AA seqDB search
MNKTLTTLYQNLDTENIDSNFQFILFGGTGDLAHNKIIPAFYNLVARDILTNKYTIIATG
RRYKNKNEYLAALYKSLKNKKKKIDSKHWKKLASHLEYFQLSFKNEADFKKLENHLVQKD
KTEKISERIFYLATAPKFFAEIAKKLDKFNLLNAGFKTNNSKLVIEKPFGHDFKSAQKLN
NTLSKIFSEKNIFRIDHYLGKEMIQNIMVIRLSNPIFRALWNKEHIDNIQIYLNESEGVK
DRGKYYDDTGVIKDMFQNHILQILSLITMEEPENLSAAEISQKKVEVFKELADNDLSNID
EHIVRGQYSSNIIENKNSKKSIKAYREEKEIDPNSKTATFMALKLFLNNQRWQDVPIYLK
SGKRLNKKEAAIAIEFKDDFHAAYTEDQKLSSNILLIKIQPEEGVSLRFNTRKPASNNKI
VPVEMEFCQSCQQFFNSPENYEGLIYDMIAGDKTLFTSWEEVSYSWKFIDKIQKKCQEQK
IKLHSYPAQTGGPKAADKLLEADNRIWQDKK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaaacattaactacactttatcaaaatttagatactgaaaatatagatagtaat
tttcaattcattttatttggtggcactggtgatttagctcataataaaattatccctgca
ttttataatctagttgcaagagatatcttaacaaataaatatacaattattgctacgggt
cgccgctataaaaataaaaatgaatatctagctgccttatataaatctttaaaaaataaa
aagaaaaaaatagattctaaacattggaaaaaattagcttctcatttagaatactttcaa
ctttcttttaaaaatgaagctgattttaagaaattagaaaatcatcttgttcaaaaagat
aaaacagaaaaaatatctgaaagaattttttatttagcaactgctcctaaattttttgca
gaaatagctaaaaaattagataaatttaatttgttaaatgctggttttaaaacaaataat
tccaaattagtcattgaaaaaccttttggccatgattttaaatcagctcaaaaattaaat
aataccctcagcaaaattttttcagaaaaaaatatttttagaatagatcattatttaggt
aaagagatgattcagaatataatggttattcgcttaagcaatccaattttcagagcactc
tggaataaagagcatattgataatatccaaatatatttaaacgaatctgaaggtgttaaa
gatcgcggaaaatattatgatgatactggagtaatcaaagatatgttccaaaatcatata
ctgcagatattatcattaattacaatggaagaacctgaaaatttaagtgctgctgaaatc
tcacaaaaaaaagtagaagtttttaaagaattagctgataatgatctcagtaatatagat
gagcatattgttagaggtcaatacagctcaaatataattgaaaataaaaatagcaaaaaa
tcaattaaagcttatagagaagaaaaagaaatagatcctaactctaaaacagcaactttt
atggcacttaaactatttttaaacaatcagcgttggcaagatgttccaatctatcttaaa
tcaggtaaaagattaaataaaaaagaagcagcaattgctattgaatttaaagatgatttt
catgctgcttatactgaagatcaaaaattaagttccaatatcttattaataaaaattcaa
cctgaagagggagtttctttaagatttaatactagaaaaccagctagtaataataaaatt
gtgccagttgaaatggagttttgtcagagctgtcagcagtttttcaattcacctgaaaat
tacgaaggtttaatttatgatatgattgctggtgataaaacactttttacaagttgggaa
gaagtttcttattcttggaaatttattgataagattcagaaaaagtgtcaagaacaaaaa
attaaactacactcttatcctgctcaaactgggggaccaaaagcagctgacaaattatta
gaagctgataacagaatttggcaggataaaaagtaa

DBGET integrated database retrieval system