KEGG   Halanaerobium praevalens: Hprae_1552Help
Entry
Hprae_1552        CDS       T01941                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpk  Halanaerobium praevalens
Pathway
hpk00071  Fatty acid degradation
hpk00280  Valine, leucine and isoleucine degradation
hpk00310  Lysine degradation
hpk00362  Benzoate degradation
hpk00380  Tryptophan metabolism
hpk00620  Pyruvate metabolism
hpk00630  Glyoxylate and dicarboxylate metabolism
hpk00640  Propanoate metabolism
hpk00650  Butanoate metabolism
hpk00900  Terpenoid backbone biosynthesis
hpk01100  Metabolic pathways
hpk01110  Biosynthesis of secondary metabolites
hpk01120  Microbial metabolism in diverse environments
hpk01130  Biosynthesis of antibiotics
hpk01200  Carbon metabolism
hpk01212  Fatty acid metabolism
hpk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hprae_1552
   00630 Glyoxylate and dicarboxylate metabolism
    Hprae_1552
   00640 Propanoate metabolism
    Hprae_1552
   00650 Butanoate metabolism
    Hprae_1552
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hprae_1552
   00072 Synthesis and degradation of ketone bodies
    Hprae_1552
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hprae_1552
   00310 Lysine degradation
    Hprae_1552
   00380 Tryptophan metabolism
    Hprae_1552
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hprae_1552
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hprae_1552
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Hprae_1552
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpk04147]
    Hprae_1552
Enzymes [BR:hpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hprae_1552
Exosome [BR:hpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hprae_1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADO77679
UniProt: E3DP46
Position
complement(1718767..1719948)
Genome map
AA seq 393 aa AA seqDB search
MKEVVIVEALRTPIGKFGGKLKNISAVDLGAQVIKAALEKTQIPKAEINEVIFGNVLQAG
LGQNPARQAAIKAGIPEEIPAVTINKVCGSGLKTVNLAAQAIKAGDGDIYVVGGMESMSQ
APYVNQKNRWGAKMGDFKMVDTMINDGLFCAFNEYHMGITAENVAEKWNLSREAQDEFSA
ISQQRAEKAMKEDRFQDEIVPVEIPQRRGENEIFSKDEGPRQGVTKESLANLRPVFKKDG
TVTAGNASGINDGAAVLIVMSKEKAEELGLEILAEIISYASAGVDPKIMGTGPIPATRKA
LSKIKLGIDDLDLIEANEAFASQSLAVIEELNLNTDIVNVNGGSIALGHPIGASGARILI
TLLHEMKKRDSKTGLATLCIGGGQGAATVVKRK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttgttattgttgaagctttaagaacaccaattggtaaatttggcggtaaa
ttgaaaaatatttctgctgttgatcttggtgcacaagtaattaaagccgctttagaaaag
acacagattcctaaagcagaaattaatgaagttattttcggtaatgttttacaagcagga
ctcggtcagaatccagctagacaggcagctattaaagcaggtatcccagaagagatacct
gcagtaactattaacaaggtttgtggttcaggtttaaaaactgtaaatcttgctgctcaa
gcaattaaagctggtgatggagatatttatgttgttggtggaatggaaagtatgagccag
gcaccttatgttaaccaaaagaacagatggggagctaaaatgggtgactttaaaatggtt
gatacaatgatcaatgatggtctattctgtgcatttaatgaatatcatatgggaattact
gctgaaaatgttgctgaaaaatggaatctgagccgagaggcacaagatgaattttctgct
atcagtcagcaaagagcagaaaaagcaatgaaagaagatagattccaagacgagatagtt
ccagtagaaattcctcagcgtagaggtgaaaatgaaattttctctaaagatgagggacct
cgtcagggagtaactaaagaaagtttagctaacttaagacctgttttcaaaaaagatggt
actgtaactgcaggaaatgcttctggaattaatgatggagcagctgtattaatagtaatg
tcaaaggaaaaggcagaagaattaggcttagaaatattagctgaaattatatcttatgct
tctgctggagtagatcctaaaataatgggaacaggacctatccctgcaactagaaaagct
ttatcaaaaatcaagcttggaattgatgatcttgatttaattgaagcaaatgaagctttt
gcttctcaatcattagcagtaattgaagaacttaatttaaatacagatattgttaatgtt
aatggtggttctattgctttaggtcatccaattggagctagtggagctcgcatcttaatt
acattattacatgagatgaaaaagagagattctaaaacaggcttagctactttatgtatt
ggtggcggtcaaggagctgcaactgtagtaaaacgtaaataa

DBGET integrated database retrieval system