KEGG   Halanaerobium praevalens: Hprae_1682Help
Entry
Hprae_1682        CDS       T01941                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
hpk  Halanaerobium praevalens
Pathway
hpk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hpk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Hprae_1682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hpk03011]
    Hprae_1682
Ribosome [BR:hpk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Hprae_1682
  Bacteria
    Hprae_1682
  Archaea
    Hprae_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TPR_MalT
Motif
Other DBs
NCBI-ProteinID: ADO77808
UniProt: E3DPW6
Position
complement(1842507..1842848)
Genome map
AA seq 113 aa AA seqDB search
MEARAVAKHLRITARKARLVTDLIKGKDVDTAVAILKSTPKKAAKIVEKVLNSATANAEN
NHDMFVDDLYVKRAFVDEGPTMKRWKARAQGSASPINKRTSHITVVLSDTKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaagagcagttgcaaagcatctgcgcattactgcccgtaaagctcgtttagtt
acagatttaattaagggtaaggatgttgacacagcagttgcaattttaaaaagcacaccg
aaaaaggctgctaaaattgtagagaaagtattgaattcagctacagcaaatgctgaaaac
aatcatgatatgtttgtagatgatctttatgttaaaagagcttttgtagatgaaggtcct
acaatgaaaagatggaaagcacgtgcacagggatcggcaagccctattaataaaagaaca
agccatatcacagtcgttctaagcgatacaaaggagggataa

DBGET integrated database retrieval system