KEGG   Halanaerobium praevalens: Hprae_1828Help
Entry
Hprae_1828        CDS       T01941                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
hpk  Halanaerobium praevalens
Brite
KEGG Orthology (KO) [BR:hpk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hprae_1828
Enzymes [BR:hpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Hprae_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ADO77953
UniProt: E3DQP2
Position
complement(2001936..2002823)
Genome map
AA seq 295 aa AA seqDB search
MSKNKNNFGERKKIDLHMHTTASDGASTPAELVDTCLELGLETIAVTDHDNLNSVKETQA
LASKKGLKVIPGIEISTYRGGAEYHILGYFIDLENDALLGLTEAILDSRVERTHKMIEKL
SQMGYPLEFEDVKKFATGVSLGRPHLARAMVEKGYIDEIGDAFTQELIAGGGKAYAEKKN
VLPAEAIEVILNAGGIPVIAHPYVINHGPALEQAEIARLKEVGLKGIEVYQTKHDQKTTE
HYKKIANELDLLITGGSDYHGENSPGILPGDCGLSRAELEKLEAFMQKENSESPK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaataaaaataattttggagaaagaaaaaaaattgatttacacatgcataca
actgcttctgatggagcttcaactccagcagaacttgtagatacttgtcttgaattaggt
ttagagactattgcagttactgatcatgataatcttaattcagttaaagaaactcaggct
ttggctagtaaaaagggtttaaaggttattccaggaatagaaatttctacttatcgtggt
ggagctgaatatcatattttaggttattttattgatttagaaaatgatgctttacttggg
ttaacagaggcaattttagattcaagagtagagagaactcataagatgattgagaaactt
agtcaaatgggttatccgcttgagtttgaggatgttaagaaatttgctacaggtgttagt
ttagggcgtcctcatctagcaagagcaatggtagaaaagggatatattgatgaaatagga
gatgcttttactcaagaattaatagctggtggaggaaaagcttatgccgaaaagaaaaat
gttttaccagctgaggcaatagaagtaattttaaatgcaggtggaatacctgtaattgca
catccttatgttatcaatcatggtcctgctcttgagcaagcagaaattgcaaggttaaaa
gaggttggattaaaaggaattgaggtttatcaaactaaacatgatcagaaaacaactgag
cattataaaaaaattgcaaatgaactagatttactaataacaggtggttctgattaccat
ggagaaaattctcctggaattttgccaggggactgtggtttaagcagagctgaattagaa
aaactagaagcttttatgcaaaaagaaaattctgaaagcccaaaatag

DBGET integrated database retrieval system