KEGG   Halanaerobium praevalens: Hprae_2020Help
Entry
Hprae_2020        CDS       T01941                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
hpk  Halanaerobium praevalens
Pathway
hpk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hprae_2020
DNA repair and recombination proteins [BR:hpk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Hprae_2020
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Hprae_2020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH Toprim_2 HHH_5 IMS_HHH HHH_3 PHF5 HHH_8
Motif
Other DBs
NCBI-ProteinID: ADO78144
UniProt: E3DRT0
Position
complement(2210841..2211440)
Genome map
AA seq 199 aa AA seqDB search
MNPYPKPMGKLIGELSKLPGIGPKTARRLSFYILGQPKTDVKNLADALLEAREQINYCSN
CNHLTEGETCTFCQSEARNRRTICVVESPRDVVAMEKTGEYKGLYHVLHGAISPMDGIGP
DEIKIRSLIPRLKQDAVEEIIVATDPNAEGDATAMYLAKLIKPLGVKVTRIAHGIPVGGD
LEYADEVTLSKALEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacccatatcctaagccaatggggaaattgatcggtgagctcagtaaactgcccgga
attgggcctaaaactgctcgccgtctttctttttatattttgggtcaaccgaaaacagat
gtaaaaaatctggcagatgctctgctagaagcccgtgaacaaattaattattgttcaaac
tgtaatcatttaacagaaggtgaaacctgtactttttgtcaatctgaagctcgaaacaga
agaacaatttgtgtagtcgaaagtccacgggatgttgtagcaatggaaaagactggtgaa
tacaaaggtctttaccatgttttacatggggctatttcgccaatggatgggattggccct
gatgaaataaaaatccgctctttaattcctcgcttaaaacaagatgcagttgaagaaatt
attgtagcaactgatcctaatgcagaaggagatgcaactgcaatgtatcttgctaagtta
attaagcctttaggggttaaagtaacccgaattgctcatggtattcctgtaggtggagac
ttagagtatgcagatgaggtaactttatcaaaagccttagagggaagaagagagctctaa

DBGET integrated database retrieval system