KEGG   Helicobacter pylori B8: HPB8_165Help
Entry
HPB8_165          CDS       T01262                                 

Gene name
rplV
Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hpl  Helicobacter pylori B8
Pathway
hpl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hpl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HPB8_165 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hpl03011]
    HPB8_165 (rplV)
Ribosome [BR:hpl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HPB8_165 (rplV)
  Bacteria
    HPB8_165 (rplV)
  Archaea
    HPB8_165 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 ptaRNA1_toxin
Motif
Other DBs
NCBI-ProteinID: CBI65722
UniProt: D7FC15
Position
154015..154383
Genome map
AA seq 122 aa AA seqDB search
MSKALLKFVRLSPTKARLIARQIQGMNAELAIASLEFTPNKAARVLSKVVASAVANGSLD
AKSALIVSCRVDAGPVLRRSIPRAKGRATAIRKPTSHVFVEVVEGKEMKSSKSHKKNQAE
GK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcgttattaaaatttgtgcggttatctcctactaaagccagattgattgca
agacagattcaaggcatgaacgctgaattagcgatcgctagtttggaatttacgcccaat
aaagcggctagagtgctttcaaaagtggtggcttctgcggtcgctaacggctctttagac
gccaagagcgctctgattgtttcttgcagagtggatgctggccctgtgcttaggcgctcc
attccaagggctaaaggcagagccacagccattagaaagccaacatctcatgtattcgta
gaagtagtagaagggaaagaaatgaaatcttctaaaagccataaaaaaaatcaagcagaa
ggtaagtag

DBGET integrated database retrieval system