KEGG   Helicobacter pylori B8: HPB8_202Help
Entry
HPB8_202          CDS       T01262                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00260  Glycine, serine and threonine metabolism
hpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpl01100  Metabolic pathways
hpl01110  Biosynthesis of secondary metabolites
hpl01130  Biosynthesis of antibiotics
hpl01230  Biosynthesis of amino acids
Module
hpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPB8_202 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPB8_202 (trpB)
Enzymes [BR:hpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPB8_202 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBI65759
UniProt: D7FC52
Position
176447..177628
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFRLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGSKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIAESHSISA
GLDYPGVGPEHSYLKEIGRAVYESASDAEALEAFRLLCQKEGIIPALESSHALAYALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttaaaagatgaaaaattccaa
aaagaatattttcgtcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagtcaagctttatctaaaacgagaggatttaatccat
ggcggggcacacaagactaatcaagccttagggcaagcccttttagcgaaaaaaatgggg
aaaacaaggattattgctgaaacaggcgctgggcagcatggcgtggcgacggctatcgct
tgcgcgttattgggtttaaaatgcgtgatttttatgggatctaaagacattaagcgccag
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtgagagaagttaattcaggg
agcgcgacgcttaaagacgccgtgaatgaagccttaagagattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccgcacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgtgatcgcatgcgttggaggggggtctaacgctatagggatattcagc
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattgcagaaagccatagcattagtgct
gggcttgattatccaggagtggggccagaacacagctatttaaaagagattgggcgcgcg
gtttatgaaagcgcaagcgatgctgaagcgctagaagccttcaggttgttgtgccaaaaa
gaaggcattatcccggcattagagagttcgcatgccttagcgtatgccttaaaactcgct
caaaaatgcgaagaagaaagcattattgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system