KEGG   Helicobacter pylori B8: HPB8_848Help
Entry
HPB8_848          CDS       T01262                                 

Gene name
galU
Definition
(GenBank) UDP-glucose pyrophosphorylase (GalU)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00052  Galactose metabolism
hpl00500  Starch and sucrose metabolism
hpl00520  Amino sugar and nucleotide sugar metabolism
hpl01100  Metabolic pathways
hpl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPB8_848 (galU)
   00052 Galactose metabolism
    HPB8_848 (galU)
   00500 Starch and sucrose metabolism
    HPB8_848 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HPB8_848 (galU)
Enzymes [BR:hpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPB8_848 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: CBI66405
UniProt: D7FDZ8
Structure
PDB: 

Position
828058..828879
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTSKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
SEPFAVILADDLCISRDYPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVIKGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctatggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgta
gaagaagcgatggaagcaggctgtgaagtgatggcgatcgttacaggcagaaacaagcgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactagc
aaagaaaacgccctaaaaagcattcgtaacattatagagaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggagaagccctcataggc
agtgagccttttgcggtgattttagccgacgacttatgcataagtcgtgattatccaagc
gtgctaaagcaaatgatttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcgctagaagaagtttcaaaatacggcgtgattaagggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctagccgtgatagggcgctacattttaaccccggatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacggatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system