KEGG   Helicobacter pylori B8: HPB8_890Help
Entry
HPB8_890          CDS       T01262                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00071  Fatty acid degradation
hpl00072  Synthesis and degradation of ketone bodies
hpl00280  Valine, leucine and isoleucine degradation
hpl00310  Lysine degradation
hpl00362  Benzoate degradation
hpl00380  Tryptophan metabolism
hpl00620  Pyruvate metabolism
hpl00630  Glyoxylate and dicarboxylate metabolism
hpl00640  Propanoate metabolism
hpl00650  Butanoate metabolism
hpl00900  Terpenoid backbone biosynthesis
hpl01100  Metabolic pathways
hpl01110  Biosynthesis of secondary metabolites
hpl01120  Microbial metabolism in diverse environments
hpl01130  Biosynthesis of antibiotics
hpl01200  Carbon metabolism
hpl01212  Fatty acid metabolism
hpl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPB8_890 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    HPB8_890 (atoB)
   00640 Propanoate metabolism
    HPB8_890 (atoB)
   00650 Butanoate metabolism
    HPB8_890 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    HPB8_890 (atoB)
   00072 Synthesis and degradation of ketone bodies
    HPB8_890 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPB8_890 (atoB)
   00310 Lysine degradation
    HPB8_890 (atoB)
   00380 Tryptophan metabolism
    HPB8_890 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPB8_890 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPB8_890 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPB8_890 (atoB)
Enzymes [BR:hpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPB8_890 (atoB)
Exosome [BR:hpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPB8_890 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBI66447
UniProt: D7FE40
Position
877819..878994
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVCVLKDALNASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMVHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMDLNDIDLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtagggagttttctaggctct
ctaaagagcgtgggcgctagagaaatgggtgtttgcgtgcttaaagacgctttgaatgcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggtgctggt
ttgggtcaaaatatcgccaggcagatccaactggacgctggcatcccgaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagctatccagttagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggagaacatgagtgca
gcgccttatctgtcgtttgacatgcgagaggggaaaagaatggggaatgcgaacatgata
gattccatggtacatgatggattatgggatgctttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagagcaagacaatttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcagggaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
aaaaaagcgcaaaaattggggttaaaaaccatggccactatcaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagtattgcgattaaaaacaaccttaaa
aatgtcaaaatggatctcaatgacatcgatctttttgaactcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgaattaaaccccaatatcgtaaatgtgaatgga
ggcgcaatagccattggccaccctattggcgcgagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggttgcgcgtcattgtgtgtgggcggt
gggcaaggtctttctgtggtagtggaacaaaaataa

DBGET integrated database retrieval system