KEGG   Helicobacter pylori SJM180: HPSJM_02650Help
Entry
HPSJM_02650       CDS       T01323                                 

Definition
(GenBank) cag island protein
  KO
K12092  cag pathogenicity island protein 7
Organism
hpm  Helicobacter pylori SJM180
Module
hpm_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpm02044]
    HPSJM_02650
Secretion system [BR:hpm02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPSJM_02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagY_M CagY_I TrbI
Motif
Other DBs
NCBI-ProteinID: ADO02126
UniProt: E1PYY5
Position
525301..530781
Genome map
AA seq 1826 aa AA seqDB search
MNEENDKLETSKKAQQHSPQDLSNEEATEANHFEDLLKEESSDNHLDNSTETQTHFDEDK
LEETQTQMDSEGNETSESSNGSLADKLFKKARKLVDNKRPFTQQKNLDEETQELNEEDDQ
ENNEYQEETQTGLIDDETSKKAQQHSPQDLSNEEATEVNHFEDLLKEESSDNHLDNPTES
SDNHLDNSTESSDNHLDNPTETKTQETKTHFDEDKLEEITDDSNDQEIIKGSKKKYIIGG
IVVAVLIVIILFSRSIFHYFMPLEDKSSRFSKDRNLYVNDEIQIRQEYNRLLKERNEKGN
MIDKNLFFNDDPNRTLYNYLNIAEIEDKNPLRAFYECIGNGGNYEECLKLIKDKKLQEQM
KKTLEAYNDCIKNAKTEEERIKCLDLIKDENLKKSLLNQQKVQVALDCLKNAKTDEERKE
CLKLINDPEIREKFRKELELQKELQEYKDCIKNAKTEAEKNECLKGLSKEAIERLKQQAL
DCLKNAKTDEERNECLKNIPQDLQKELLADMSVKAYKDCVSRARNEKEKKECEKLLTPEA
KKKLEQQVLDCLKNAKTDEERKKCLKDLPKDLQSDILAKESLKAYKDCTSQAKTEDEKKE
CEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKTEDEKKECEKLLTPEAKKKLEEAKKSVK
AYLDCVSQAKTEDEKKECEKLLTPEAKKLLEQQALDCLKNAKTDEERKECLKDLPKDLQK
KVLAKESVRVYLDCVSKAKNEAERKECEKLLTPEARKLLEEAKESVKAYLDCVSRARNEK
EKKECEKLLTPEARKLLEESKKSVKAYLDCVSQAKNEAERKECEKLLTPEARKLLEEAKE
SVKAYKDCVSRARNEKEKKECEKLLTPEARKLLEESKKSVKAYLDCVSQAKNEAERKECE
KLLTPEARKLLEEAKKSVKAYLDCVSRARNEKEKKECEKLLTPEARKLLENQALDCLKNA
KTEAEKKRCVKDLPKDLQKKVLAKESVRVYLDCVSKAKNEAERKECEKLLTPEARKLLEE
AKESVKAYKDCVSRARNEKEKQECEKLLTPEARKLLEQEVKKSVKAYLDCVSRARNEKEK
KECEKLLTPKARKLLENQALDCLKNAKTEAEKKRCVKDLPKDLQKKVLAKKSVKAYLDCV
SRARNEKEKQECEKLLTPEARKLLEEAKKSVKAYLDCVSRARNEKEKQECEKLLTPEARK
LLEEAKESLKAYKDCLSQARNETERRACEKLLTPEARKLLEQEVKKSVKAYLDCVSRARN
EKEKQECEKLLTPEARKFLEKQRQQKDKAIKDCLKNADPNDRAAIMKCLDGLSDEEKLKY
LQEAREKAVLDCLKTARTDEEKRKCQNLYSDLIQEIQNKRAQNKQNQLSKTERLHQASEC
LDNLDDPTDQEAIEQCLEGLSDSERALILGIKRQADEVDRIYSDLRSRKTFDNMAAKGYP
LLPMDFKNGGDIATINATNVDADKIASDNPIYASIEPDITKQYETEKTIKDKSLEAKLAK
ALGGDKKDDDKEKSKKPTAETKAESNKIDKDVAETAKNISEIALKNKKEKSGDFVDENGN
PIDDKKKEEKQDETSPVKQAFIGKSDPTFVLAQYTPIEITLTSKVDATLTGIVSGVVAKD
VWNMNGTMILLDKGTKVYGNYQSVKGGTPIMTRLMIVFTKAITPDGVIIPLANAQAAGML
GEAGVDGYVNNHFMKRIGFAVIASVVNSFLQTAPIIALDKLIGLGKGRSERTPEFNYALG
QAINGSMQSSAQMSNQILGQLMNIPPSFYKNEGDSIKILTMDDIDFSGVYDVKITNKSVV
DEIIKQSTKTLSREHEEITTSPKGGN
NT seq 5481 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaaaacgataaacttgaaacttctaaaaaagcccaacaacattcaccccaa
gatctatctaatgaagaagcaacagaagccaatcattttgaagatcttttaaaagaagaa
agctcagacaatcatcttgacaattccacagaaactcaaacccattttgatgaagacaag
ctagaagaaacccaaactcaaatggattctgaaggtaatgaaacttcagaatctagcaat
ggcagtctagcagacaagttattcaaaaaagccagaaaattagttgataataaaagacct
ttcactcagcaaaagaatttagatgaagaaacccaagaattgaacgaagaagacgatcaa
gaaaataatgagtatcaagaagaaactcaaacgggcttaattgatgatgaaacttctaaa
aaagcccaacaacattcaccccaagatttatccaatgaagaagcaacagaagtcaatcat
tttgaagatcttttaaaagaagaaagctcagacaatcatcttgacaaccccacagaaagc
tcagacaatcatcttgacaattccacagaaagctcagacaatcatcttgacaaccccaca
gaaactaaaacccaagaaactaaaacccattttgatgaagacaagctagaagaaataact
gacgactctaacgatcaagagattatcaaaggaagcaaaaagaaatacattattggtggc
attgtagtcgctgttcttatcgtgattattttattttctagaagcatttttcactacttt
atgcctttggaagataaaagctctcgttttagcaaagacaggaatctttatgtcaatgat
gaaatccaaataaggcaagagtataaccgattgctgaaagaacggaatgaaaaaggcaat
atgatcgataagaatcttttcttcaatgacgatcccaatagaaccttatacaactatttg
aatattgcagaaattgaggacaaaaacccattgagagccttttatgagtgtattggtaat
ggtggcaactatgaagaatgtttgaagcttatcaaagacaaaaaacttcaagagcaaatg
aaaaagactctagaggcttataatgattgtatcaaaaatgccaaaactgaagaagaaagg
atcaagtgtttagatttaatcaaagatgaaaacctgaaaaaaagcttactgaaccaacaa
aaagttcaagtggcgctagattgtttgaaaaacgctaaaaccgatgaagaacggaaagag
tgcctaaaactcataaatgaccctgagattagagagaaattccgtaaggaattagagctt
caaaaagagcttcaagagtataaggattgtatcaaaaacgccaaaacagaagctgagaaa
aacgaatgcttgaaaggcttatctaaagaagctatagaaagattgaaacaacaagcgcta
gattgtttgaaaaacgctaaaaccgatgaagaacgaaacgagtgcttgaaaaatattccc
caagacttgcaaaaagaactactagctgatatgagcgtcaaggcttacaaggactgcgtt
tcaagagctaggaatgaaaaagagaaaaaagagtgtgagaaattgctcacgcctgaagcg
aaaaaaaagttagaacaacaggttctagattgtctgaaaaacgctaaaaccgatgaagaa
cgaaaaaagtgtttgaaagatctccctaaagacttacaaagcgatattttagctaaagag
agtctgaaagcttataaagactgcacatctcaagccaaaactgaagatgagaaaaaagag
tgtgagaaattactcacccctgaagcgaaaaaacttttagaagaagaagccaaagagagc
gttaaggcttatttggattgcgtatctcaagccaaaactgaagatgagaaaaaagagtgt
gagaaattactcacccctgaagcgaaaaaaaagttagaagaagctaaaaaaagcgttaag
gcttatttggattgcgtatctcaagccaaaactgaagatgagaaaaaagagtgtgagaaa
ttactcacccctgaagcgaaaaaacttttagagcaacaagcactagattgtttgaaaaac
gctaaaaccgatgaagaacggaaagagtgcttgaaagatctccctaaagacttacagaaa
aaggttttagccaaagagagtgttagggtttatttggattgcgtatcaaaagccaaaaac
gaagctgaaagaaaagaatgcgagaaattgctcacgcctgaagcgaggaaactattagaa
gaagctaaagagagcgttaaggcttatttagactgcgtttcaagagctaggaatgaaaaa
gagaaaaaagagtgtgagaaattactcactcctgaagcgagaaaactattagaagaatct
aaaaaaagcgttaaggcttatttggattgcgtatctcaagccaaaaacgaagctgaaaga
aaagaatgcgagaaattgctcacccctgaagcgagaaaacttttagaagaagctaaagag
agcgttaaggcttacaaggactgcgtatcaagagctaggaatgaaaaagagaaaaaagag
tgtgagaaattactcacgcctgaagcgaggaaactattagaagaatctaaaaaaagcgtt
aaggcttatttggattgcgtatctcaagccaaaaacgaagctgaaagaaaagaatgcgag
aaattactcacgcctgaagcgagaaaacttttagaagaagctaaaaagagcgttaaggct
tatttagactgcgtatcaagagctaggaatgaaaaagagaaaaaagagtgtgagaaatta
ctcacccctgaagcgaggaaactattagagaatcaagcactagattgtttgaaaaacgct
aaaaccgaagctgagaaaaaaaggtgtgtcaaagatctccctaaagacttacagaaaaag
gttttagccaaagagagtgttagggtttatttggattgcgtgtcaaaagccaaaaacgaa
gctgaaagaaaagaatgcgagaaattactcacgcctgaagcgagaaaacttttagaagaa
gctaaagagagcgttaaggcttacaaagactgcgtatcaagagctaggaacgaaaaagag
aagcaagaatgcgagaaattactcacccctgaagcgaggaaactattagagcaagaagtt
aaaaagagcgttaaggcttatttagactgcgtatcaagagctaggaatgaaaaagagaaa
aaagagtgtgagaaattgctcacccctaaagcgaggaaactattagagaatcaagcgcta
gattgtttgaaaaacgctaaaaccgaagctgagaaaaaaaggtgtgtcaaagatctccct
aaagacttacagaaaaaggttttagctaaaaaaagcgttaaggcttatttagactgcgtt
tcaagagctaggaatgaaaaagagaaacaagaatgcgagaaattactcacgcctgaagcg
agaaagctattagaagaagctaaaaaaagcgttaaggcttatttagactgcgtttcaaga
gctaggaatgaaaaagagaaacaagaatgcgagaaattactcacgcctgaagcgagaaag
ctattagaagaagctaaagagagccttaaagcttataaagactgtctctctcaagctaga
aatgaaactgaaaggagagcctgcgagaaattactcacccctgaagcgagaaaactatta
gagcaagaagttaaaaagagcgttaaggcttatttagactgcgtttcaagagctaggaat
gaaaaagagaaacaagaatgcgagaaattactcacgcctgaagcgaggaaatttttagag
aaacagcgccaacaaaaagataaagcgataaaggattgcttgaaaaacgccgatcctaac
gacagagcggctatcatgaagtgtttggatggtttgagcgatgaagagaagctcaaatac
ctgcaagaagctagagaaaaggctgtcttggattgtttgaaaacggctaggaccgatgaa
gaaaaaagaaaatgccaaaacctttatagcgatttgatccaagaaatccaaaataaaagg
gcacagaacaaacaaaatcaattgagtaaaacagaaaggttgcatcaagcaagcgagtgc
ttggataacttagatgaccctactgatcaagaagccatagagcaatgtttagagggattg
agcgatagcgaaagggcgctaattctaggaatcaaacgacaagctgatgaagtggatcgg
atttatagcgatctaagaagccgcaaaacctttgataacatggcggctaaaggttatcca
ttgttaccaatggatttcaaaaatggtggcgatattgccactattaacgccactaatgtt
gatgcggacaaaatagctagcgataatcctatttatgcttccatagagcctgatattact
aagcaatacgaaacagagaaaaccattaaggataagagtttagaagctaaattagctaag
gctttaggtggcgataaaaaagatgacgataaagaaaaaagtaaaaaacccacagcagaa
actaaagcagaaagcaataagatagacaaagatgtcgcagaaactgccaaaaatatcagc
gaaatcgctcttaagaacaaaaaagaaaagagtggggattttgtagatgaaaatggtaat
cccattgacgataaaaagaaagaagaaaaacaagatgaaacaagccctgtcaaacaggcc
tttataggcaagagtgatcccacatttgttttagcgcaatacactcccattgaaatcact
ctgacttctaaagtagatgccactctcacgggtatagtgagtggggttgtagccaaagat
gtatggaacatgaacggcactatgatcttattagacaaaggcactaaggtgtatgggaat
tatcaaagcgtgaaaggtggcacacctattatgactcgtttaatgatagtctttactaaa
gccattacgcctgatggggtgattatacctctagcaaacgctcaagcagcaggcatgttg
ggtgaagcaggggtagatggctatgtgaataatcacttcatgaagcgcataggctttgct
gtgatagcaagcgtggttaatagcttcttgcaaaccgcgcctatcatagccctagataaa
ctcataggccttggcaaaggcagaagtgaaaggacacctgaatttaattacgctttgggt
caagctatcaatggcagtatgcaaagttcagctcagatgtctaatcaaattctagggcaa
ctgatgaatatccccccaagtttttacaaaaatgagggcgatagcattaagattctcaca
atggacgatattgattttagcggcgtgtatgatgttaaaattaccaacaaatctgtggta
gatgaaattatcaaacaaagcaccaaaactttgtctagagaacatgaagaaatcaccaca
agccccaaaggtggcaattga

DBGET integrated database retrieval system