KEGG   Helicobacter pylori SJM180: HPSJM_03500Help
Entry
HPSJM_03500       CDS       T01323                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpm  Helicobacter pylori SJM180
Pathway
hpm00071  Fatty acid degradation
hpm00072  Synthesis and degradation of ketone bodies
hpm00280  Valine, leucine and isoleucine degradation
hpm00310  Lysine degradation
hpm00362  Benzoate degradation
hpm00380  Tryptophan metabolism
hpm00620  Pyruvate metabolism
hpm00630  Glyoxylate and dicarboxylate metabolism
hpm00640  Propanoate metabolism
hpm00650  Butanoate metabolism
hpm00900  Terpenoid backbone biosynthesis
hpm01100  Metabolic pathways
hpm01110  Biosynthesis of secondary metabolites
hpm01120  Microbial metabolism in diverse environments
hpm01130  Biosynthesis of antibiotics
hpm01200  Carbon metabolism
hpm01212  Fatty acid metabolism
hpm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPSJM_03500
   00630 Glyoxylate and dicarboxylate metabolism
    HPSJM_03500
   00640 Propanoate metabolism
    HPSJM_03500
   00650 Butanoate metabolism
    HPSJM_03500
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPSJM_03500
   00072 Synthesis and degradation of ketone bodies
    HPSJM_03500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPSJM_03500
   00310 Lysine degradation
    HPSJM_03500
   00380 Tryptophan metabolism
    HPSJM_03500
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSJM_03500
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPSJM_03500
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPSJM_03500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpm04147]
    HPSJM_03500
Enzymes [BR:hpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPSJM_03500
Exosome [BR:hpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPSJM_03500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADO02292
UniProt: E1PZF1
Position
709564..710739
Genome map
AA seq 391 aa AA seqDB search
MNEVVIVAAKRSAVGSFLGSLKNVGARQMGVSVLKDALNASGLEPSDVDSVIVGNVLGAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREDQDAFAL
QSQLKARAAINAGKFQEEITPIEIASKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKVQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDIHLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttatagtggcggcaaagcgtagtgctgtagggagttttttaggctct
ctgaagaatgtgggcgctaggcaaatgggcgttagcgtgcttaaagacgctttgaacgcg
agcggacttgaacctagcgatgtggattctgtcattgtaggcaatgttttaggcgctggt
ttgggtcaaaatatcgccagacagatccaactggacgccggtatccctaatgacagaaac
gcttttagcgtcaatatggtttgcggatcgtctatgaaagctattcagttagcgcatgat
agcatcatgcttgggcgcgatgaagtggtggtgtgcggtggcgtggaaaacatgagcgca
gcgccttatctgtcgtttgacatgcgagaggggaaaagaatggggaatgcgaacatgata
gattccatgatacatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagatcaagacgcattcgcgctc
caatcgcaactcaaagcgagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgagtaaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgcctttaaaaaagacggatcggta
acggcagggaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
aaaaaagtgcaaaaattggggttaaaaacaatggccactatcaaggggtttggcttgggt
ggttgcagtccggatattatgggcatatgcccaagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaacgacatccatctttttgaactcaatgaagcctttgccgcg
caaagcattgccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagcgattggccaccctattggcgcgagcggcgctaggatattagtcacttta
ttgcatgaaatgaaaagaagcgggcatggcgtgggttgcgcgtcattgtgcgtgggtggc
ggtcaagggctatcagtggtagttgaacaaaaataa

DBGET integrated database retrieval system