KEGG   Helicobacter pylori SJM180: HPSJM_05495Help
Entry
HPSJM_05495       CDS       T01323                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpm  Helicobacter pylori SJM180
Pathway
hpm00010  Glycolysis / Gluconeogenesis
hpm00020  Citrate cycle (TCA cycle)
hpm00620  Pyruvate metabolism
hpm00640  Propanoate metabolism
hpm00650  Butanoate metabolism
hpm00680  Methane metabolism
hpm01100  Metabolic pathways
hpm01120  Microbial metabolism in diverse environments
hpm01130  Biosynthesis of antibiotics
hpm01200  Carbon metabolism
Module
hpm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSJM_05495
   00020 Citrate cycle (TCA cycle)
    HPSJM_05495
   00620 Pyruvate metabolism
    HPSJM_05495
   00640 Propanoate metabolism
    HPSJM_05495
   00650 Butanoate metabolism
    HPSJM_05495
  Energy metabolism
   00680 Methane metabolism
    HPSJM_05495
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSJM_05495
Enzymes [BR:hpm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSJM_05495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: ADO02665
UniProt: E1Q0H4
Position
1114243..1115187
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPSGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFDSNKTIELADM
AVDSLMFPLFEIFNGKELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgagaaatttcaaggc
tcgcacttgctttgcccaggttgtgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggcggtg
tatccgcacacttcatgggatgtgccttggatccatattggttttgaaaatggctctaca
gcgatttcaggggtggaagcgatgtataaggctttagtgaataagggccgctatcaaggt
caaaagccaaaatttgtggcgtttgggggcgatggggctagttatgatattggtcttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcttggataatgaa
aactacgccaataccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccatcaggatcggttagctttggtaagaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggagtcccttatgtggcgcagctctcgcctaacaaatggaaagac
atgaataaaaagattaaaaccgcgctagacactgaagggccttgctttatcaacgctctt
agcccatgcacgactgaatggaaatttgattccaataagaccattgaattagcggatatg
gctgtggatagcttgatgttccccttgtttgaaatctttaatggcaaggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaggaaaacgaacacatcattgaagaattgcaaaaagacgtgaac
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system